SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P21787 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P21787
Domain Number 1 Region: 391-514
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000118
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P21787
Sequence length 667
Comment b3 domain-containing protein os07g0563300-like
Sequence
MARRRQALALEMAVWVIRETGTALPFGPPSMSKGSVRSPLAVEGRERISNVPQQANVPCD
GTDLTSPTRKELIALKVLFCAFEQGSFCETFHSDVAGWRNCEACGKRVHCGCVASAPTYV
FLDVGGVECIACARKSLAMAPNQMLSSPMLMHQHVSERRDLPVKSGRPITSPFSGQWRQA
PHMWNMTSLQSDLQQRLSYEFDRPSNIEKLAPGGRHSISVHEKKFEELPERIMSASHNNI
ARDRYALGNTGENDPDSTRKSVIPDPCSTSSGVKIEAKANSSIKLQPLPISKEDSSPLIG
LAAPFSSTNGSREPMKFLSNQPPQLTTSPLPKQFYPEGIADTELQIQMRNGRARVDARSR
TQLLPRYWPRITDQELQQISGEYPSTLLIIIYLMLSASDAGRIGRLVLPKKCAEARYGTV
RCTDGTGQSVYRYPVGPAYFPTISQPEGLPLKVQDASGKDWVFQFRFWPNNNSRMYVLEG
VTPCIQAMQLQAGDTVTFSRIDPEGKLVMGFRKASSGSTEQDSQTHISGGDFSTPPEGND
KIAVTDLIGNVPFRASKASIEPSNPINAADKSSWPKFTKAGFIQQDGPAARSLQVPSKRK
ASTLGSKSKRLRIENEESMELKLTWEEAQELLRPPPNSSPGIVVIEGHEFEEYEVYCKSF
NYMIYSI
Download sequence
Identical sequences ITC1587_Bchr8_P21787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]