SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P23466 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P23466
Domain Number 1 Region: 103-182
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000373
Family B3 DNA binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P23466
Sequence length 262
Comment b3 domain-containing transcription factor fus3-like
Sequence
MAGINKQQEAPSTVRDGGGRWSPSSTAESPVVALQQPTPMLHLEKCSHFHVHAEQGINVG
LRAGLESASPCSWCKVHLKIMSIYYFLQRFEILAHLSFSKLWKEAEAHLPCLTSREGIVI
NMDDLDNLQAWTFKYRFWPNNRSRMYVLENTGDYVKKNCLQLGDFILIYKDDSKDRYVIR
AKKTGSAELCVAPADEGIFDSIVPDIVVGSARYSDLFLPLADGINIAYGYGLSCAFDQDF
PMTFLDESTGSASIASHKSSDH
Download sequence
Identical sequences ITC1587_Bchr8_P23466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]