SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P23528 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P23528
Domain Number 1 Region: 175-281
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-31
Family B3 DNA binding domain 0.00000732
Further Details:      
 
Domain Number 2 Region: 58-113
Classification Level Classification E-value
Superfamily DNA-binding domain 5.56e-16
Family GCC-box binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P23528
Sequence length 332
Comment ap2 domain-containing transcription factor
Sequence
MESSCVEEASSIDSEKRLQAPLHAAVALQRLGSGVSLVIDPAPEGGIEAESRKLASYRYK
GVVPQPNGRWGAQIYERHQRVWLGTFGDDAEAARAYDVAAQRFRGRDAVTNFNPLSESDD
EEAGELSFLETHSKAEIVDMLRKHTYRDELQQSKRSCGAGGFAGKRTTPSYLRSSRVILF
DKSVTPSDVSKLNRLVIPKQHAEKHFPLKSSSGMAYKGVLLNVEDAGGKVWRFRYSYWSS
SQSYVLTKGWSRFVKEKNLKARDVVSFWRSTGPEKQLYIDWRTEAVASNRTMTPAIWPLP
VVKLFGVNISELPSVSGGDGKRGREMESSPSQ
Download sequence
Identical sequences ITC1587_Bchr8_P23528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]