SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P23971 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P23971
Domain Number 1 Region: 141-280
Classification Level Classification E-value
Superfamily POZ domain 6.8e-20
Family BTB/POZ domain 0.02
Further Details:      
 
Domain Number 2 Region: 397-483
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.36e-19
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P23971
Sequence length 600
Comment btb poz ankyrin repeat protein
Sequence
MVSHPFIDVQENKLMIGKLFLHDLPLEQYAKLIWLSQKDVIIIIKVVHSVTINYHQGSQS
IPTEACVKLFFVDDHHNKMNYRWTLQVKVKSNEDEKKKRGQRSPKGKEIGTEICKKGEIG
RHRRGRVQEGREVVIMEETLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCVLAARS
LFFRRFFCGSDPSSPRRPGGAAVIPVNSVTYEVFLLILQFLYSGQTAVVPQKHELRPGCG
ERGCWHTHCTAAVDLALDTLAAARSFGVKQLEQITEKQLGSMVEKASIEDVMRVLMAAWQ
QDMQQLWNTCSLLVAKSGLPAELLAKHLPFDVVARIEELRLRSSLARRPSFLACHHHTHP
IDVAISSADLEDHHQKIRRMRRALDSSDVELVKLMVMGEGLNLDDSLALHYAVENCSREV
VKALLELGAADVNCPAGAAGKTPLHIAAEMVCPDMVAVLLDHHADPNIRTTEGVTPLDIL
RTMTSDFLFKGTLPGLSHVEPNKLRLCLELVQSAALVMSRDDANCGAGTNPTSTAIYPRT
NPETGACNATPSSSSMINLSLDSRMVYLNLGMAEQFGCKMDDNGGDESSPSSLYPSHGFP
Download sequence
Identical sequences ITC1587_Bchr8_P23971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]