SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P24132 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P24132
Domain Number 1 Region: 145-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.03e-43
Family B3 DNA binding domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr8_P24132
Domain Number - Region: 1052-1110
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000118
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P24132
Sequence length 1189
Comment auxin response factor 7a
Sequence
MKAVVNGAAVPNPCEGESIFQLVLAALSAAGGGMGMTRVAMTGDRNTINPELWHACAGPL
VTLPPVGSLVVYFPQGHSEQVAASMQKDIDAHVPNYPNLPSKLICLLHNVTLHADLETDE
IYAQMTLQPANSYDKEALQASELALKQTRPQTEFFCKTLTASDTSTHGGFSVPRRAAEKI
FPPLDFSMQPPAQELQARDLHDNLWTFRHIYRGQPKRHLLTTGWSLFVGGKRLFAGDSVL
FIRDKKQQLLLGIRRANRQPTNISSSVLSSDSMHIGILAAAAHAAANHSPFTVFYNPRAS
PSEFVVPFAKYQKAVYSNQISLGMRFRMMFETEELGTRRYMGTITGFSDLDPVRWKNSQW
CNLQVGWDESAAGERRNRVSIWDIEPVVAPFFICPPPFFRKRPIPPGVPVAGKEPLIIEV
EIQSLDNDESSEMENFFKRAMPWLGEEICIKDSQTQSTIMPGLSLVQWMNLQQNPSVANQ
TLLAETLHSLNGAVMQNLGTTDLCRQYGLHPQTLQHNNIQFNTNRFPPQAQEVDEIIKVP
IPLNQLSVASTPPQQMPDLTVQTKQQLVNQALPNQRHNNVVQPQVLVQTQVQPQLQPVLQ
NNQLSQSSLPQDQQHPQQLLLQQLRQQLQQQQHQQQHHQQLQQQYEQQQSGTPVMVPSQM
NEQLSDQHIQLQLLKKLHQPQQQQQSFSQSRMQQPQHSQIQEYQKAAIDVPQQLSNSHAQ
VQQPVILQQCAKAISQVARPQTFQNQPQQNPPQQQLLHGELHRAILPASPATNLIRASGS
LLGAGRAQSGVTDDIPSCSTSPSANNVASLPHSILNRTQHCNISTEKMSQSVVTMLGPNF
FEAAAVNPDISKEITKDVHDVKLLIPISKVQNQAVVAPQTYISNAVQMDCLDTTSSATSV
CLSQTDGPLRQSLPLSSSNQPSMLRDPLPDIDVQGTDPRNSLLFGVNIDDSLGIPLATDS
LLINNVDSGKYQNHIAGNVVANYNTSKDIQQELSSTMVSQSFGVPDMAFNSINSTANENG
FLNKNSWVPTPPLPLQRMRTYTKAYKRGAVGRSIDVTHYSGYDELKHDLARMFSIEGQLE
DRQRIGWKLVYVDHENDVLLVGDDPWDALLYVFWKKLMLSRTSEYLRKGVCELCSVHQDI
VPTRSPTDELGCRSREQQPPKSGLQQFRWWKSLERPWRSELRQPFGWIV
Download sequence
Identical sequences ITC1587_Bchr8_P24132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]