SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P24956 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P24956
Domain Number 1 Region: 628-793
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000118
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number 2 Region: 371-609
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000203
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P24956
Sequence length 1349
Comment uro-adherence factor a
Sequence
MDWRFEESLDAHVDRDGKHILTYGESDLLQKEGNIYVEEEASLDGEFSKFEESIYAKESS
HLFKQISEVEEASSVEDLKTKNRVANVNLLVMEKEKELELQLEESGRGQELSESEKSLPK
SEFHLANQKLVKMNRYCEEHELHQKAMKDDILEALTANDTKHKKLLEVKEAFMGLAAELK
SSRKKMKELQEGLVSSANEMCKLEEFSKHSSSQAEIESKRALQFGNMLELAQFKAKEIEG
QMDNLQKGLKGLYERIAENQHVKGVLHINAVELSTIQEKLEISRSTVADFEQKLVSNDSI
IHELTQELNIHKASEERMKTHVLELEILLAASKEELQAKHANLEEIELKLQEKIGASFKN
QVLWQKVTLQSLQKDLSDLTREKVTLQSTVADLSMKLSMNEEQCRQLEANLNLADQNFNK
TDSLLSQALLRNKELEQNQRSFEELHHDMKKVMDATTKRNLELENLVQASKLAEESLKTK
LRQSEMRSFSAEKRNMELKQQFNTTEMRCLEAESEIEDLNNQVKELTTLLRKIDEENSLS
RRRFMGYENKIGQLESSLSKSFRRNTELEKEINCLLEKCVEHEGQATAAHQSNAELEDKV
QTSHSKTEIEKCVKQGTTAHQSNVELGDKVQSSHFETENAVTGADELEQLLETANYRIQE
LEQLLATMEAKYRDTETELKQYSSKVSALFAEIEAYQARSESLESVLQAANEKESELTDA
LDATIKDRKKLEDLSNIQAKSLSEAENLIQILQNKLKSLGAKLESAEEQLQASSLREKEL
VEKLRSTGEQLKHDGKAVEDINTRNLEMNSLNESLDKDTGFKFKEATLRCNQKESEFKEL
HEKLKFLEEQKTLYKDQALESNEEVASLKAELEANAMKLVSLDNKVEELNQNVLESDLRA
EQISLENELMAVTNSKLRLELEACQLKLNQLNQLLNTNHAEMEATSEQLASHVKTISKLT
DENSTYLELQSATEYRLRETEVQLHETIEKFKQKDSEVRDLSEKLLALETQLRSHDEQAS
ELAAIASSRKDKLEDTLLKLQNLEAFVEHLKRSSEISKLENEDLMGENLTMSQELATYKT
KINELKIVFNAVVAEKQVTSIQLHDSQKEMKVLMQQINSDKEKHQLQITAAKEEYNKLTE
SYQKTKKELEAIIIQLEEQLSEQKTKEISLCADMEILKAELADKSLMQEQISELESKLLF
AQKSYMEEIEGMRSTVVEKDVILIPKLEEQTCIIEERDTLIQQLKKVQNDLDIAHRTIKE
QFQNKTAEGELQNEIEAKSRDVGLGTSITMYGRNIKENNDNHMNQALETKSLNLATQIDE
EASGAMAFKFILGVALVSMFIGIILGKRF
Download sequence
Identical sequences ITC1587_Bchr8_P24956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]