SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr9_P26617 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr9_P26617
Domain Number 1 Region: 117-275
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-40
Family B3 DNA binding domain 0.0087
Further Details:      
 
Domain Number 2 Region: 936-1013
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000932
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr9_P26617
Sequence length 1302
Comment auxin response factor
Sequence
MKVPTACGFAGTPLEGEKKRIDSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAATMQK
EIDGIPNYPSLPSKLICVLLDVTMHADAETDEVYAQMTLQPVNKYDREAMLASEIGLKQN
KQPAEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFTMQPPAQELVAKDLHDVSWTFR
HIYRGMNLHLVSLLVHFCNKCSLCQPKRHLLTTGWSVFVSTKRLSAGDSVLFIRDEKSQL
LLGIRRANRQQHALSSSVLSSDSMHIGILAAAAHAATNNSPFTIFYNPRASRSEFVIPLA
KYNKAIYTQVSLGMRFRMMFETEDSGVRRYMGTITGISDLDPVRWKNSQWHNLQVGWDES
TATERRTRVSIWEIEPVVTPFYMCPPPYLRPNFATSPGVPDEYEVGNGLHRVMPWLNDEY
SLKDSQSAIFPGLSLVQWMAVQQNRHLMASATQPACFSPMVASATQDGVVTEDPTKMLSF
QTPAASGPSFNSKSSPQAQLNQPLQLPHQLQQQPHLLTQSSVSMQHQLQSSPLQQKSINL
QQQQFQQPGQLQQSQPQQLRPVANQEATDQQLMQQQTCNGQIGLQTHSSSPYLQPSHLQQ
QGLQGSCFSSMGSLSQSPLPQILPVQQPLECQRSLLQKQQDQLQHIMQPQIQMQMLQKLQ
QQQLLSQLSPPLQCQLSQQLTQQNQHFQDFQQQLDGSNLLPLQSDQLHQAHKSSALDSQK
SPLLLRTQSSLSGTNVPCSSNFPSTNRNIDSLSLHSKVQQGQKVLVEETVAPLLDNMLPE
LQGKTQVMAKHEQFNIKESIQMPNQLAVTDQLDASSTTSFCLEGSGHEGVSLPPHCLDGN
GQDHRDNFLLGTMPDTLLSRGLGTRKDIQNLVSGYGQQKDIDTELSTADISSQSFGVPDM
SFKPGCSTDVVVTEGVLNRGVWANQPPPPPPRMRTYTKVQKRGSVGRCIDVTRYKGYDDL
RRDLARMFGIEGQLEDTYRTDWKLVYVDHENDILLVGDDPWEEFVSCVQSIKILSAVEVQ
QMSLDDTTDLVETLFKRFIESAAGANREEIGDLSEFSEVRQRDRRRFVEITEKARLLAEL
ATRMGACWESAGRNPRVYRKSTGRSPESSPKGNSTLPLNRWNRQTGRWNHPEHEVSGSGT
VGLGSGTTQHSKSFGGGTTGLGGGTAQYTVTHEGTSRVKESKINILVHSYELFWMKPKAK
DLKIFSLEELIGSLMTYEMNNVTKRELENNLPKDRKDLGHRTQEDHSSISLSDGKLKLQM
KQKLKSKKNGITCFERKKKKRLANYALMDFNDEIDSSKKKIV
Download sequence
Identical sequences ITC1587_Bchr9_P26617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]