SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr9_P26743 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr9_P26743
Domain Number 1 Region: 69-160
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-28
Family B3 DNA binding domain 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr9_P26743
Sequence length 346
Comment y3209_orysj ame: full=b3 domain-containing protein os03g0120900
Sequence
MEFTSGRRDGLSIIGEEKQKDAFTHPSIFALSSSSLSPSTSTAFRWHVRPCDGGAAGDGR
RESDFFTEKEHMFDKVVTPSDVGKLNRLVIPKQHAERYFPLDPAAQGKGLLLSFEDRTGK
SWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDIVSFGRGVGESTRDQLYIDWKPRPVN
RDIPILPLNPLTGVSLARPLGPWGGQFFIPPRAVHDHHRPGFGYNGMNWGSTGGGQLLFF
RSSMARPPQIAAQRDSGSGPPMVLSSPPLVRNHAEAKRVRLFGVNLDCAESKGDEHLVPS
ARSPSAAQLQPASTLPFHPLPHGSMEFSEASSSTNKDLHLPLDLGL
Download sequence
Identical sequences ITC1587_Bchr9_P26743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]