SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_BchrUn_random_P35520 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_BchrUn_random_P35520
Domain Number 1 Region: 181-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-30
Family B3 DNA binding domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 58-114
Classification Level Classification E-value
Superfamily DNA-binding domain 7.19e-17
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_BchrUn_random_P35520
Sequence length 357
Comment ap2 erf and b3 domain-containing transcription repressor tem1-like
Sequence
MKTSSLEDGCSEAEKQSPPQWPQPPPAPVGLQRLGSGTSVVLNLEVSVEAESRKLPSSRY
KGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAVQRFRGRDAITNFKPLVEAD
GNDAAEELSFMNSHSKAEIVDMIRKHTYQDELHQSSRSARADRRHNPPHGATEEWLSGPH
REHLFDKAVTPSDVGKLNRLVIPKQQAEKHFPLQQAGAAAFKGVLLSFEDACGKLWRFRY
SYWSSSQSYVLTKGWSRFVKEKGLRAGDVITFQRSTAPEKLLFIDRKTRALCRHAAAGVQ
APRFPVEVVRLFGVDILKIPVAVASDVTEGNGVYWNGKRMRDMESISSRELLRKQCI
Download sequence
Identical sequences ITC1587_BchrUn_random_P35520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]