SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_BchrUn_random_P37641 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_BchrUn_random_P37641
Domain Number 1 Region: 977-1096
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.82e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0069
Further Details:      
 
Weak hits

Sequence:  ITC1587_BchrUn_random_P37641
Domain Number - Region: 159-326
Classification Level Classification E-value
Superfamily TPR-like 0.0036
Family BTAD-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_BchrUn_random_P37641
Sequence length 1146
Comment pentatricopeptide repeat-containing protein at4g21065-like
Sequence
MIVPSEKHLKGSLHLVNHTLPSTPSRGRAAEQTCLALLQACISLRHLLQTTAFILKSGLQ
SNPLVLTKFAAASSSLDALEVATSLLFSPHASTHLYDAFLFNTVIRSHAQSDRLGERRLA
ISYFSAMLRCRLLPNKFTFPFLLKACASLPEPSSVGAQVHACVVKYGYNSDPYVQNTLIH
MYSGAPSSLDCARELFDRMPKTSPVTWSAMIGGYVRSGFSDKAVALFREMQGRGIQPDEI
TVILVLSACADLGALELVRWLGSYVERENIPKALPLCNALLDALAKCGDVDGAVALFEQM
HAKSIVSWTSVIDGLALHGRGKEAVRVFEMMKGAGVVPDGVAFISVLTACCHSGMVDEGR
HYFDSMKSDLGIEPQIEHYGCMVDLFSRVGMVERALEFVRTMPMEPSPVIWRMLIGACRV
HGRLELGERIAKNLLDEDPVHDSTYVVLSNLYALGRQWQKKWETRRAMSERGIRKVPGCS
LVELNGEIYEFIAGDESQLQYRGVYEMLEEIGRKIKLAGYVPRKTEVLLDIDEEDKEDAL
HWHSEKLAVAFVLLKTPPGTRIRIVKNLRVCGDCHAAFKFISKVYDREIVVRDRNRFHCF
ENADGSRVQQRLMEITYATSSNLDLADGVVGMDMAAWEVRSERPWPSLHSSSAPPVSRWW
STLKAMTATEWLEMLLPCTRWICRYRSGDYLELDLTAGITVGVMLVPQTRLATSIHQPLC
DLRLYFFLSHYNCFVPSKILPGFSWSPFLMGSVILTLITLMKHLVGEIPQGLPTFHIPRE
FQHLKSLISTAFLITGVAILESVGIAKALAAKNGYELDPNQELFGLGMANICGSFFSAYP
ATGSFSRSAVNNESGAQTGLSGIITGLTIGCALLFLTPWFRDIPQCALAAIVVSVGISLV
DYEKAMFLWQVDKKDFLLWMLTCLATLFLGTEIGVLVGVFSSLAFVIHESANPCIAILGR
LPGTTIYRNIDQYPEACLYRGIVVIRIEAPIYFANISYIKDRLREYELDISKNRKWEPQA
SRIHFVIIEMASVPYIDSSAVEALKDLHQEYKLHEVQISISNPNQKVLLTLARSHLIELI
GKSWFFVSVHDAVKACIQQTPNLMGTSPGGRRDAAQTSQPGLVQKLRKQEDESAVEWEYL
LPQEET
Download sequence
Identical sequences ITC1587_BchrUn_random_P37641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]