SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_BchrUn_random_P37786 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_BchrUn_random_P37786
Domain Number 1 Region: 555-625
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000151
Family B3 DNA binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ITC1587_BchrUn_random_P37786
Domain Number - Region: 659-684
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00353
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_BchrUn_random_P37786
Sequence length 754
Comment viviparous1 protein
Sequence
MADHKVEGEEKVLGVGCGGDTAAGVDDIVMNIDGEDLIFSEDTFPCLPDFPCLSSPSDTP
SPSSASTLHANNAVLSSCSSTSSSSSSSSSSSSWSFLQVPDSGRVADMQQQAAQVPSVDD
IMMLPPLPPPLDHHQSSEFADGLDILGDIDLFDLSIDPWDPPSLFHADEASAAVISGGDE
AFGSREKKPCQAVEEGRLHGHGEGVPQQAQEEESSEELARIFLEWLRSNKDSISPEDLRS
IKLKRATIECAARRLGRTKQGRTQLLKLILTWVQNNHLQRKRHRLPYSYDHQPRPFPISP
NPNQLDYNCNPWSPYSMDPSTAATHPALLSAYAGGGNGEMGYPSATANPYPYHHSCGTSS
VVVNNQPFSPSPDFVDPAGGPWPTQLASALPQFAPYPVTSASHPLSMAPPQYSGGMTNQF
LGHPMYHQGQRLPGTTSATKEARKKRMARQRRFSSLHQHRNHNQPLHLQHAHHPVGSTEG
ANGSSHSNTRNWGFWTGMSSSSHQMNHMAEAQNASNMQQTPPPPAAQLPQRPQLTTASTS
EKRQGWKGEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELDARDGISIPMEDIGT
SQVWNMRYRFWPNNKSRMYLLENTGESRVSFFFFVFFSNIVFQFMVGIWSNTQYNDNSGD
FVRSNGLQEGDFIVIYSDVKCGKYMIRGVKVRQPVEARAPSSRNTGKAHQRRNGLEKMAG
ASKMKGRSLIHDDADNYYDDDDDDDDDVPPSMHG
Download sequence
Identical sequences ITC1587_BchrUn_random_P37786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]