SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383316567|ref|YP_005377409.1| from Frateuria aurantia DSM 6220

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383316567|ref|YP_005377409.1|
Domain Number 1 Region: 17-96
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.16e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.0083
Further Details:      
 
Domain Number 2 Region: 211-360
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.0057
Further Details:      
 
Domain Number 3 Region: 112-253
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000000144
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0046
Further Details:      
 
Domain Number 4 Region: 366-445
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000196
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383316567|ref|YP_005377409.1|
Sequence length 461
Comment precorrin-3B synthase [Frateuria aurantia DSM 6220]
Sequence
MQNHGSPRRNRSVQAAQAACPGLINLVQAVDGGLCRIRLAGGRMTAVQARALAAAAREHA
EGPLEITNRANLQLRGIRAEAGPGLIQALIDAGLGPLPASDRVDTVALSRRDARRNVMIS
PLAGIDPQMRIDTSALAADLLQAMQQDAALDGLSPKFAVLLDGGERLVDRRHPHDIWLCI
DQRDLPQPPGLWLGLASAPAVPVHCPGYTAPQDAVTTVLALMRAFMELATAGQLRMRDVL
ADQGLQVLLSRARRHGARLKLATPPAGALPCATGVEPPLDPARLGQQPQAGGDLCLIGFQ
APLARLDADMLEGLAELSSQLGRGELRFTPWQGGLLPHIRAVNAPAALTGLRQLGLITDA
ADPLARLLACAGRRGCARTQADTKADALRLARAELPPTGIHLSGCPRSCAAASPAGHTLL
AVDGNHYDLYRRGSGRDFGECLGRHLTLEMATGIMRPPAAE
Download sequence
Identical sequences H8L513
gi|383316567|ref|YP_005377409.1| WP_014402733.1.76910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]