SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383318091|ref|YP_005378933.1| from Frateuria aurantia DSM 6220

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383318091|ref|YP_005378933.1|
Domain Number 1 Region: 142-339
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.96e-54
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000122
Further Details:      
 
Domain Number 2 Region: 9-141
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.4e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.0023
Further Details:      
 
Domain Number 3 Region: 424-552
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.81e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000922
Further Details:      
 
Domain Number 4 Region: 341-417
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.23e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383318091|ref|YP_005378933.1|
Sequence length 568
Comment sulfite reductase (NADPH) hemoprotein subunit beta [Frateuria aurantia DSM 6220]
Sequence
MSVITSKPTESVEEIKARSHFLRGTLVEGLADETTGSISEDDNKILKFHGSYQQDDRDLR
EPRRQQKLEPAWQFMIRARIAGGVVSPQQWLAFDEIATTWANHSLRITTRQTFQLHGVIK
RHLKKTMAAINQALISTVAACGDVNRNVVSSANPVESSAHRLALEWASRLSEHLKPKTRA
YHEIWLDGEPVVGGEPEQEPLYGPTYLPRKFKIGIAIPPTNDVDVFAQDLGLIAIIEEGR
LQGFNVAVGGGMGTTHGDASTYPRLASIIGFVRPDQLLRLAEAVIEVQRDFGNRQVRKHA
RLKYTIDHRGLEWFVHEVEQRLGAALTASRPWHFEHNGDRFGWLQGDDGRWHLTLRTEAG
RIADTEARPWLTGLREIARIHQGDFRMTCNQNLIIANVPADQRASIDRLVEQFGLTGYAR
QSGLRRNSVACVALPTCALAMAESERYLPLLLPRLEALLDKHGLTDAPIVFRLSGCPNGC
SRPYLGEIALVGRGPGRYDLRLGADFQGLRLNRLFRENIAEPDILAELDVLLARYARERH
EAEYFGDFLLRQELLPEAVHVLNVVEYA
Download sequence
Identical sequences H8L1Z6
gi|383318091|ref|YP_005378933.1| WP_014404254.1.76910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]