SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig1692.frz3.gene2 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig1692.frz3.gene2
Domain Number 1 Region: 252-285
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000994
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.002
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig1692.frz3.gene2
Domain Number - Region: 357-379
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.000392
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0041
Further Details:      
 
Domain Number - Region: 72-221
Classification Level Classification E-value
Superfamily RNI-like 0.0251
Family 28-residue LRR 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig1692.frz3.gene2
Sequence length 379
Comment MhA1_Contig1692.frz3.gene2 MhA1_Contig1692.frz3.gene2
Sequence
MSQLFDERIYRFPCGESFPRVSDNMDFNGLDHMHDLACRKRKRFIIYHRRNNYSRKLFTP
PLGFYERLKKMLHNGYVKRLVFESFTFTDLFVEKFFEYLNLPFTHLDVVYIHFCSFRRIS
SESFHNLLDLLSSKQYFIDKSIHCLSKHVSKPLLDKHSIKLAEVFFFGSAFARNLHLRDD
LFPIDNETFLNFTNTLSAYPNVSRKFFGIAQCRITSEFLRHYGKLVEQAQQNNLVSNRLD
QQKKNFWLFKHEELYEGVINDVINQVRPAFSDDGVDIEILRHLKKSQTGTEISQLDGGGP
TMTDSSSEEEEVESSETKEHLNVNEPDVSKNSGDEEEPPLNSDDDGDDENVETVFETDNI
MNIHGKEFCFRRCNGEAEW
Download sequence
Identical sequences A0A1I8BAC5
MhA1_Contig1692.frz3.gene2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]