SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig883.frz3.gene10 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig883.frz3.gene10
Domain Number 1 Region: 81-311
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 2.75e-79
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000494
Further Details:      
 
Domain Number 2 Region: 9-81,312-511
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.85e-65
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig883.frz3.gene10
Sequence length 527
Comment MhA1_Contig883.frz3.gene10 MhA1_Contig883.frz3.gene10
Sequence
MSNNESIKQKVCLVVIDGWGLSDEEHGNAIAKARTPVMDKLCSGNWQKLEAHGLHVGLPE
GLMGNSEVGHLNIGAGRVIYQDIVRINLAVKRNEFVKNSQIIASAERAKSGSGRLHLLGL
VSDGGVHSHIDHLFALIRAFKDLHVPKLFIHFFADGRDTSPTSGAGYLEQLLKFISSENY
GELATIVGRYYAMDRDKRWERIKMAYEAIIGDIGHKSTIDKAVGVVKERYAQSETDEFLK
PIVFSDDGRVKDNDTLIFFNYRADRMRQICECLGMERYKGLQSSTPHPKNLEVSGMTQYN
KEFPFPSLFPPTTHTNVLAEWLASQGVSQFHCAETEKYAHVTFFFNGGREVQFQDEERCM
VPSPKVATYDLQPEMNASGVAEKMIEQIKLGKHPFIMCNFAPPDMVGHTGQFEPAVKACE
ATDEAIGRIYDACQSHNYILMVTADHGNSEKMIASDGGKHTAHTCNLVPFTCSSSTFIFK
LTPPFGDDGKERARALRDVAPTVLQLMGLSCRRRWMVYLYLKIETRK
Download sequence
Identical sequences A0A1I8BZQ1
MhA1_Contig883.frz3.gene10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]