SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig515.frz3.gene15 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig515.frz3.gene15
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-42
Family Motor proteins 0.00000502
Further Details:      
 
Domain Number 2 Region: 158-283
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000000000419
Family Myosin rod fragments 0.00046
Further Details:      
 
Domain Number 3 Region: 277-375
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000157
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number 4 Region: 368-474
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000837
Family Myosin rod fragments 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig515.frz3.gene15
Sequence length 545
Comment MhA1_Contig515.frz3.gene15 MhA1_Contig515.frz3.gene15
Sequence
MPLKINAHLVLEQLRCNGVLEGIRICRQGFPNRIPFQEFRHRYEILTPNLIPKSFVDGKE
ACKRIIEALELDKYYYRIGQSKVFFRAGMLAHLEEERDRKLCGLIISFQSQCRAYLARRL
YQKRVQQSNAIRILQRNGLAWLKLRDWQWWRLYTKVKPLLQVTNQEEAIRKREEELNILR
DRLVNNEKDMLETQLLLDKMVEERVSLQAQLQIESDDRAGAEELADELKQRNIKLEDVVN
DLTIRLEEVDDAQSKLIQSNKKLDETVKDLESQLEDEESARQKLMLDKKNLENRLKELQE
RYAQMQDANERLQLEKRSVDNKLIQLSDLLQEGEDKAKQGMKYRQKLESQLSELTERYES
ELRLREFAEKEKKNIASGIAQQSSMLDEKHSKIEYLTTELGKYEAELVQLRNKSDDDIAT
ISGLQKHSRKLELLLEEAREDLETEKKQKLSLQSKMRQLEQELADVQALQEEQEIEKHQI
LNELDTARLQLKDSKKRVDEDVIQQYEEQFKRFTKDLDNVRQQLADAETAQKRIENSKKK
LQQEV
Download sequence
Identical sequences A0A1I8BSB8
MhA1_Contig515.frz3.gene15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]