SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig594.frz3.gene10 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig594.frz3.gene10
Domain Number 1 Region: 307-601
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.72e-82
Family Complement components 0.0000231
Further Details:      
 
Domain Number 2 Region: 680-795
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.79e-23
Family Alpha-macroglobulin receptor domain 0.0017
Further Details:      
 
Domain Number 3 Region: 102-154
Classification Level Classification E-value
Superfamily E set domains 0.00000252
Family SVA-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig594.frz3.gene10
Sequence length 859
Comment MhA1_Contig594.frz3.gene10 MhA1_Contig594.frz3.gene10
Sequence
MFGYAMPLSAPVYAKSHSRWKKMRFSSFKFFKSSGLEMEQTKRIRSEFPETWIWTDSNFT
TDENGEAVYETTVPDTITSWIASAFAINEQTGLGLAPSQLKLRVFRPFFLRLELPYSVKR
GEKMALQVLIFNYLETEQEVTVTLKPNPGFELLQKDGSPLRPPRQDLKQNNGNNKRNTIL
YSRSLSVPGGGGTRAVYFPLKFTEIGQIRLSLQGRAEQANDAIEQTLLVEPEGYRVDRNI
PLVIDLSQITTLTTTTETNEQNIQTTEIQQQQQTPQFHQTLEMQFPADYVTGSRKARFEL
IGDIMGPVLANLDSLVRMPYGCGEQNMVTLVPNIVVLSYLRATHRSTPQMELKIKKYMET
GYQRELTYRHSDNSFSAFGEHDPHGSTWLTAFVINSFKQAQAFIYVDDKILEDSIAFLIA
QQQESGAFMERGEVLHKAMQGGAAEGGYSLTAYVLIVLLQNHVQNKVTEKARIYLESKLE
EQKTDAYSLAIACYSLHLANSEKKTDCLKLLESHQITSNDGNVHWSVIKKEKPSISSLYQ
QSQPVDIETTSYALLTYMLLDDKIKALPIVKWLTAQRNSLGGFTSTQDTVMALQALGAYA
ERSYGAAFNVTIKIQNGADSHTFNINPQNSLVLQSYELSNLDSPVEIEAFGSSLAFIQLQ
YFYYRLPSQRDELAFYCENDLKEQRNGQRLLLDLCCNYTRSGRSNMAVAEIQALSGFKFD
EEEIGKLTGIADLQRVELDKDYTKANIYFNSLSDVPVCLSLSSDLVYQVADQKPAQYLLY
DYYQPDQQLKSSYGGNQQQTRSLEDTCSECWPDPAALQSSSTSTKTSNNSTTSSPGLFSL
TALLACFSSFFTYIFCCYC
Download sequence
Identical sequences A0A1I8BTY6
MhA1_Contig594.frz3.gene10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]