SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336233871|ref|YP_004586487.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336233871|ref|YP_004586487.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily FlgN-like 1.44e-20
Family FlgN-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336233871|ref|YP_004586487.1|
Sequence length 160
Comment FlgN family protein [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MSAKQLIEVLENHVKLHKGLLELANKKTEVLKKGDTEALNGIVKEEQKYIAAIGRVEQER
IRVVHAMIGETDEPTLTACILQTEGTERAMLEKLRDDLSAVLSELKNVNQLNEQLAKQSL
QFVHVMLNMLMPQPKEVNYRKPNVAPSSYEGGSSLFDSKA
Download sequence
Identical sequences A0A1Y3PS37
WP_013876211.1.10372 WP_013876211.1.15103 WP_013876211.1.21702 WP_013876211.1.44525 WP_013876211.1.50686 WP_013876211.1.65251 gi|336233871|ref|YP_004586487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]