SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336234378|ref|YP_004586994.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336234378|ref|YP_004586994.1|
Domain Number 1 Region: 128-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-21
Family Extended AAA-ATPase domain 0.0075
Further Details:      
 
Weak hits

Sequence:  gi|336234378|ref|YP_004586994.1|
Domain Number - Region: 5-89
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0994
Family DNA repair protein MutS, domain III 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336234378|ref|YP_004586994.1|
Sequence length 312
Comment Primosomal DnaI domain-containing protein [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MMERIDQLLNRLLGKKGFQQHYVQMKRRILSHPEIQAFLREHEREISKEMVDRSLMKLYE
FMEQSKNCSQCPSLDQCKNFLKGYHPRLVIKGAAIDVEYDRCPAKIKYDERKRQESLIQS
LFVPREILQASLSDIDLADEGRMKAIELADRFVSEYEPGKKMKGLYLYGSFGVGKTYILG
AIANALAKKNVPSLIVYVPEFFRELKSSLQDQTINEKLDYVKKVPILMLDDIGAESMSSW
VRDDLLGPILQYRMFENLPTFFTSNFDLQQLAHHLTYSQRGEEEQMKAARIMERIRYLAQ
PVEVKGKNRRLE
Download sequence
Identical sequences A0A0F6BJR0 A0A150LP17 A0A178TZD9
gi|312109956|ref|YP_003988272.1| WP_013400249.1.100411 WP_013400249.1.10372 WP_013400249.1.15103 WP_013400249.1.21702 WP_013400249.1.26140 WP_013400249.1.44525 WP_013400249.1.50686 WP_013400249.1.65251 WP_013400249.1.95592 WP_013400249.1.96739 gi|336234378|ref|YP_004586994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]