SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336234425|ref|YP_004587041.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336234425|ref|YP_004587041.1|
Domain Number 1 Region: 27-99
Classification Level Classification E-value
Superfamily Colicin 0.0000222
Family Colicin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336234425|ref|YP_004587041.1|
Sequence length 252
Comment hypothetical protein Geoth_0962 [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MRRFCLFFSLAMIFILNSIPISVFAYSYGDPNEEKVAEAYKQMAEKLNEQPPNFAEACAI
FETVKEEIDMHMGKEPSQAVLSALDKKDKEAVLKNMEKILVLNIARRLENIEKNFEQYDT
SKRLLAKAFATYEALSPMVQGKDAALDKRLRDEFNKALQSLGNPGLFGVGEKETDIEQFK
KSKETILTSLQKHFGLKSLKVGHFSESATEKPQEVQKKEWTDLSKLKNWIPIAILVVVIA
GVVVYSWRRKRT
Download sequence
Identical sequences gi|336234425|ref|YP_004587041.1| WP_013876490.1.15103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]