SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336234497|ref|YP_004587113.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336234497|ref|YP_004587113.1|
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 6.15e-59
Family Obg GTP-binding protein N-terminal domain 0.0000000931
Further Details:      
 
Domain Number 2 Region: 160-359
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.12e-55
Family G proteins 0.00000015
Further Details:      
 
Domain Number 3 Region: 356-428
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 5.49e-25
Family Obg GTP-binding protein C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336234497|ref|YP_004587113.1|
Sequence length 428
Comment GTP-binding protein Obg/CgtA [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MFVDQVKIYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFVVDEGLRTLMDFRY
QRHFKAARGENGMSKNQHGKNAEDLIVKVPPGTVVIDADTNQVLADLTENGQRFVVAKGG
RGGRGNTRFATPANPAPEIAENGEPGEERNVILELKLLADVGLVGFPSVGKSTLLSVVSA
AKPKIAEYHFTTLVPNLGVVETDDGRSFVMADLPGLIEGAHQGVGLGHQFLRHIERTRVI
VHVIDMAAIEGRDPYEDYLVINEELKQYNLRLTERPQIIAANKMDMPNAEENLKKFREKL
GDKVPVFPISAVTRQGVRELLFAIADLLETTPEFPLHETEEPGLQRVVYKYEKEEIPFTI
TRDSDGTFILSGDKVEKLFKMTDFSREESVRRFARQLRAMGVDDALRERGAKDGDIIRLL
DYEFEFVD
Download sequence
Identical sequences A0A0F6BK27 A0A150LNL3 A0A178U0B8
WP_003248899.1.100411 WP_003248899.1.10372 WP_003248899.1.15103 WP_003248899.1.21702 WP_003248899.1.26140 WP_003248899.1.44525 WP_003248899.1.50686 WP_003248899.1.65251 WP_003248899.1.95592 WP_003248899.1.96739 gi|336234497|ref|YP_004587113.1| gi|312110073|ref|YP_003988389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]