SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336235461|ref|YP_004588077.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336235461|ref|YP_004588077.1|
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily AF1862-like 1.44e-33
Family Cas Cmr5-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336235461|ref|YP_004588077.1|
Sequence length 135
Comment Cmr5 family CRISPR-associated protein [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MAKNIQRVGIENGRAAFAFEAVKKVKEDKRIGKFENYRSYVKKMPSLIQVNGLGQALAFC
YQKEKEYGAIYQALHEWFQEKYPHAFQGDKKEFVQVVINLPSAEYRLWTMEALALLNWMR
KFVDGMAKENEEKEQ
Download sequence
Identical sequences WP_013876947.1.15103 gi|336235461|ref|YP_004588077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]