SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336235578|ref|YP_004588194.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336235578|ref|YP_004588194.1|
Domain Number 1 Region: 1-250
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.23e-59
Family Tetrapyrrole methylase 0.00073
Further Details:      
 
Domain Number 2 Region: 378-496
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.3e-23
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|336235578|ref|YP_004588194.1|
Domain Number - Region: 282-369
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0419
Family Duplicated SiR/NiR-like domains 1 and 3 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336235578|ref|YP_004588194.1|
Sequence length 520
Comment precorrin-3B C(17)-methyltransferase [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MKGKLLIVGFGPGSKEHMTKRAREAIEESDIIIGYKTYVDLVADLIGNKQVISTGMTEEV
SRAQEAVKWAERGKTVAVISSGDAGVYGMAGLVYEVLIEKGWTRESGIDVEVIPGISAIH
SCAALLGAPVMHDACTISLSDHLTPWALIEKRIEAAAAADFVIALYNPKSGRRTRQIVEA
QRILLRYRSPSTPVGLVKSAYRARQHIVLTDLAHMLDYDIGMLTTVIIGNSSTFVYDGLM
ITPRGYQRKYTLSAAEQPLKPHERLRKEAEPWALDPTGLSSAREIAEDALQKLAIRQRDA
AVFAPAIFEIAVSPGVANKNFTAKQMMLLAEIAGEGGTMMYTPDHYLKLEVPASDPDRII
ARLKEAGLTVAPIGDVLTVKACDFCDGEKKDAIPYAQQLYEQLGGMALPKELKLGVNGCG
MACYGAVREDIGIVYRKGAFDLFLGGKTIGRNAHPGQLVAEGIPPSEIVSVVTRIIQEYK
ENAYPNERFHKFFKRVKQVGGFAYQEEEQTAKIEVPVCGE
Download sequence
Identical sequences A0A0F6BN34 A0A1Y3PA51
gi|336235578|ref|YP_004588194.1| WP_013400946.1.100411 WP_013400946.1.15103 gi|312111130|ref|YP_003989446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]