SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336236097|ref|YP_004588713.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336236097|ref|YP_004588713.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-85
Family Protein kinases, catalytic subunit 0.00000101
Further Details:      
 
Weak hits

Sequence:  gi|336236097|ref|YP_004588713.1|
Domain Number - Region: 364-425
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.021
Further Details:      
 
Domain Number - Region: 501-562
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000719
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336236097|ref|YP_004588713.1|
Sequence length 655
Comment serine/threonine protein kinase with PASTA sensor(s) [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MLIGKRLNDRYKIIRLIGGGGMANVYLARDIILDRDVAVKVLRLDFANDEQFIRRFRREA
QAATSLNHENIVTIYDVGEDEGIYYIVMECVRGCTLKQYIHEHAPLPVPKALHIMEQLTS
AIAHAHENGIIHRDIKPQNILMDENGNVKVTDFGIAVALSSTTITQTNSVLGSVHYLSPE
QGRGGIATEKSDIYSLGIVMFELVTGRLPFSGESAVSIVLKHLQTETPSPKAWNPSIPQS
VENIILKATAKDPFYRYRSAREMNEDIRTALDPDRVNEQKFVIPADDEETTKAIPVIKEK
HVNAGSEQQTIVYEEKQEEEKRDEAKPKKKRKWLFVWLTALFLFLVAAGVSAVTWIPDLI
FPKEVTMPNVINKDYDKAVEQLSSLGLEIKDTIDVENDEIAEGKVVRTKPEAGMTVKQGS
AVVIYKSIGKKKVEFGNFIGQDIGIVEEQLKNENFMKITRNGRYSDKPLGTILDQFPYEG
DKVVPEETEVIFTVSLGPEKITLKDLTGYTEKSVRDYANDQQLHVNMQYEYSDKVPEGLV
ISQTPKANEKVDRGDTITIVISRGREPLPTKTVIKEIEIPYEPAEEGQVVEAQLYIQDAN
HNMTTPYKTYRLTGPVKETVTFEIPYKETAYYRVIVNNVVKDEGIIPYPDNRQKE
Download sequence
Identical sequences A0A150LRA6 A0A178TY06
gi|336236097|ref|YP_004588713.1| WP_003251829.1.10372 WP_003251829.1.15103 WP_003251829.1.21702 WP_003251829.1.26140 WP_003251829.1.44525 WP_003251829.1.50686 WP_003251829.1.65251 WP_003251829.1.95592 WP_003251829.1.96739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]