SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336236155|ref|YP_004588771.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336236155|ref|YP_004588771.1|
Domain Number 1 Region: 170-568
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.06e-105
Family beta-Lactamase/D-ala carboxypeptidase 0.0000246
Further Details:      
 
Domain Number 2 Region: 51-219
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.83e-48
Family Penicillin binding protein dimerisation domain 0.001
Further Details:      
 
Domain Number 3 Region: 583-635
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336236155|ref|YP_004588771.1|
Sequence length 646
Comment stage V sporulation protein D [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MRVSHVTVRKRLMIVFLVGVLIFAIIDIRLGYVQLIIGDMLTERAKNSWSRNIPFEPKRG
EILDRNGVPIATNMSAPTVYVIPRQIENPAETAEKLAKALNMPVEKAYRHITKKTSIERI
PEGRKISNEKANEIRALGLKGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLMGLELYYD
KELRGQRGSVQFYSDAKGKRMPNMTDEYTPPTDGLDLMLTIDSRIQTIVERELDIAEAKY
NPDGIIAIAMNPNTGEILAMASRPTFDPANYRNVPPEIYNRNLPVWSTYEPGSTFKIITL
AAALEEKKVDLLNDHFYDPGYVKVAGATLRCWKKGGHGSQTFLEVVQNSCNPGFVELGQR
LGKEKLFDYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVEQATTSFGQGVSVTPIQQVA
AVSAAVNGGILYTPYVAKQWVDPETGKVIIRNTPKAKRRVISEETSKQVRYALESVVAQG
TGKGAYVEGYRVGGKTGTAQKAKGGRYLTDNYIVSFIGFAPADDPQLVVYVAVDNPKGTV
QFGGVVSAPIVGKIMGDSLRVLGVKPRKGQMEKERAWNDPKMVEVPNLIGLSKKDLQQQL
FNLKLDVSGEGDVVIEQAPKPGVKVKEGSTIRIYLAAETETFREGE
Download sequence
Identical sequences A0A0F6BPX6
WP_013401313.1.100411 WP_013401313.1.10372 WP_013401313.1.15103 WP_013401313.1.21702 WP_013401313.1.44525 WP_013401313.1.50686 WP_013401313.1.65251 gi|336236155|ref|YP_004588771.1| gi|312111772|ref|YP_003990088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]