SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336236156|ref|YP_004588772.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336236156|ref|YP_004588772.1|
Domain Number 1 Region: 191-586
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.35e-98
Family beta-Lactamase/D-ala carboxypeptidase 0.00000418
Further Details:      
 
Domain Number 2 Region: 57-239
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.83e-45
Family Penicillin binding protein dimerisation domain 0.0000721
Further Details:      
 
Domain Number 3 Region: 656-710
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000128
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0045
Further Details:      
 
Domain Number 4 Region: 598-653
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000811
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336236156|ref|YP_004588772.1|
Sequence length 736
Comment peptidoglycan glycosyltransferase [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MEKKKHSNTDKGAAILFFLFSLLFFVLLARFIQLQVTGVADGQVLAVKAEEKYKQKRTIE
AKRGTIFDRNGEVLAQDMPSYTVVAVLDPKMTTDPDHPRHVVDPEKTAKKLAPLLKMDVD
EVKRILTKDAKQVEFGPNGRNISYELKEKIEALNLPGIGFIRDTKRFYPNGDFASYVIGY
AQKEDKSEAAGKMGIEKSLDKYLREKDGYVSFAGDVSGFRLPNTKESIVPPDNGANVYLT
IDQKIQTFLEDAMNDVEKQYKPKKIIAIVADPKTGKILAMATRPSFDPNKRNIQNYFNDA
ISYPYEPGSTMKIFTLAAAINEGVYNGNEQYRSGYYKVGRNIIRDHNKVGWGTITFNEGV
QRSSNVAFSILVEEKLGEDRFLQYLHRFHFDRKTGIDLPGEAVGQIHYKYPIERVTTGFG
QGTSVTPIQQIQAATAIANGGKMMKPFVIDRIVDPDTNKVIFKNEPEVVEQPITKETAQK
VLDILETVVTSEKGTGRPYQIEGYRVAGKTGTAQIPSPNGGYLTGYQNYIFSFLGMAPKE
DPRLIMYVAVQQPKLSYTETGAAPVSHIFTSVMKNSLQYLHIQPSSEQKTPKTKTKGIEV
GSYIGRSTEEAVKELKEKQLVPIVIGNGQQIEDHLPISGDTVIAGERVMLKTNGKTVMPD
VRGWSLRDVMKVAELLGLRPSIKGSGYVISQNIRPGALIKKGDYLIVELEEPEKWKERME
QEQKEAATKKNDGPVE
Download sequence
Identical sequences A0A0F6BPX7 A0A150LRI9 A0A178TWE7
WP_003251932.1.100411 WP_003251932.1.10372 WP_003251932.1.15103 WP_003251932.1.21702 WP_003251932.1.26140 WP_003251932.1.44525 WP_003251932.1.50686 WP_003251932.1.65251 WP_003251932.1.95592 WP_003251932.1.96739 gi|336236156|ref|YP_004588772.1| gi|312111773|ref|YP_003990089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]