SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336236776|ref|YP_004589392.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336236776|ref|YP_004589392.1|
Domain Number 1 Region: 135-292
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.14e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000397
Further Details:      
 
Domain Number 2 Region: 391-536
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.45e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00016
Further Details:      
 
Domain Number 3 Region: 13-134
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.24e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.00039
Further Details:      
 
Domain Number 4 Region: 270-401
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.6e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336236776|ref|YP_004589392.1|
Sequence length 543
Comment ferredoxin--nitrite reductase [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MAYEKVWANNPNLNKMELKKLQKDGLKIFDDIPYYAKHGFSSIPQEEWDLFKWAGLYLQR
PKEAGYFMMRVCVPSGILNNEQLETLAGIARDYGRGLFDITTRQSVQFHWLQIEQIPDIF
DRLKRVGLSTAGACGDITRNIVGNPLAGIDPDELFDTREIVREIYEFFQRNEDFSNLPRK
YKISISANVYNTVNAEIHCLSFTPAKKVIDGKEVLGFHVKVGGGLSSVPYLAQTLDVFVT
PDRVKDVAVAVTTIFRDYGYREKRHRARLKFLVADWGIDKFKEKLIELTGPLPSKGEDVQ
KGWNPGYFYGVHRQKQEGLNYIGFNVPVGRLSADEVFEIARIARQYGNGEVRFCNSQNLI
IPNIPDKHVDAVLQEKVFERISIRPKTFTGYSVSCTGTEFCNLALVETKERMRRVAAYLD
EHLELDVPVRIHMVGCPNSCGQRQIADIGLQGIKTKTKDRGMIEAFEIYVGGTLLNGGKY
NQNQKLKGKIGAEQISEVLLHLLTYFKETKLPGETFLAYLDRVGIEALQAELDRILAQVS
TVA
Download sequence
Identical sequences A0A0F6BRI0 A0A1Y3Q433
gi|312112326|ref|YP_003990642.1| WP_013401645.1.100411 WP_013401645.1.10372 WP_013401645.1.15103 WP_013401645.1.21702 WP_013401645.1.44525 WP_013401645.1.50686 WP_013401645.1.65251 gi|336236776|ref|YP_004589392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]