SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|432327949|ref|YP_007246093.1| from Aciduliprofundum sp. MAR08-339

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|432327949|ref|YP_007246093.1|
Domain Number - Region: 13-87
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.059
Family Galactokinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|432327949|ref|YP_007246093.1|
Sequence length 191
Comment hypothetical protein AciM339_0024 [Aciduliprofundum sp. MAR08-339]
Sequence
MGLLNELEEIKRQERASKKNLQKLKKNFYEDTINRIEELRMNARVYMEKMDLEKAGKIMG
EIKKIEKALDEIIALRTRKILLSTLWKNEREVKNLTKEEEVLYREVKDAIERHKNAIYRR
EVSPLQEKKEKERKVEEIEKEEYVLARVKVPSMKIALPDRNLILKKEDVLHMPKKIFSIL
SKNDAVEEIKL
Download sequence
Identical sequences L0HGP8
gi|432327949|ref|YP_007246093.1| WP_015282579.1.32628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]