SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387621594|ref|YP_006129221.1| from Escherichia coli DH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387621594|ref|YP_006129221.1|
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily CutC-like 1.24e-77
Family CutC-like 0.000000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387621594|ref|YP_006129221.1|
Sequence length 248
Comment copper homeostasis protein CutC [Escherichia coli DH1]
Sequence
MALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRP
RGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTF
HRAFDMCANPLYTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVR
AENLHHFLDAGVLEVHSSAGAWQASPMRYRNQGLSMSSDEHADEYSRYIVDGAAVAEMKG
IIERHQAK
Download sequence
Identical sequences A0A026UWM6 A0A027TSJ3 A0A028E3Q5 A0A069XRB1 A0A070EVP8 A0A073G7E3 A0A074HXN3 A0A080FXD8 A0A0A8U9G1 A0A0E1M0A4 A0A0E2TPS0 A0A0F6MDY7 A0A0I4C176 A0A125X2X4 A0A127GJK3 A0A1S6TBX5 A0A1W2MCI6 A0A1X3JGT5 A0A1X3L2J8 A0A226KAA6 A0A236Q8H7 A7ZN00 B1XHE2 B6I1F2 B7M2G5 C4ZQF8 C8U3G5 C8UC51 D2AI60 D6HY20 E0J583 F4NEX3 F5NVS7 H4UKC6 I0VLN3 I2SPB7 I2US00 I2W461 I2X2R2 I6H328 J7QF38 J7RU21 K4VQZ9 M9H670 P67825 P67826 Q0T3Q3 Q3Z2Q2 V6FRD7 V8FM16 W1EW01
gi|383177883|ref|YP_005455888.1| gi|378712682|ref|YP_005277575.1| gi|170081530|ref|YP_001730850.1| gi|387621594|ref|YP_006129221.1| gi|388477948|ref|YP_490136.1| gi|443617954|ref|YP_007381810.1| d1x7ia_ d1x7ib2 d1x8ca_ d1x8cb2 gi|260868472|ref|YP_003234874.1| gi|386709736|ref|YP_006173457.1| gi|386704399|ref|YP_006168246.1| gi|386709736|ref|YP_006173457.1| gi|110805847|ref|YP_689367.1| gi|260844284|ref|YP_003222062.1| gi|387621594|ref|YP_006129221.1| gi|544390514|ref|YP_008565053.1| SfR33 gi|260855814|ref|YP_003229705.1| gi|384543529|ref|YP_005727592.1| gi|471333715|ref|YP_007557192.1| gi|209919300|ref|YP_002293384.1| gi|238901089|ref|YP_002926885.1| gi|90111351|ref|YP_025309.2| gi|218554462|ref|YP_002387375.1| gi|157155916|ref|YP_001463179.1| NP_707762.3.23235 WP_001185741.1.1000 WP_001185741.1.100044 WP_001185741.1.100063 WP_001185741.1.100066 WP_001185741.1.100085 WP_001185741.1.100135 WP_001185741.1.100185 WP_001185741.1.100252 WP_001185741.1.100315 WP_001185741.1.100346 WP_001185741.1.100389 WP_001185741.1.100425 WP_001185741.1.100441 WP_001185741.1.100448 WP_001185741.1.10048 WP_001185741.1.10051 WP_001185741.1.100543 WP_001185741.1.100571 WP_001185741.1.100573 WP_001185741.1.100667 WP_001185741.1.10068 WP_001185741.1.100725 WP_001185741.1.100752 WP_001185741.1.100753 WP_001185741.1.100778 WP_001185741.1.100796 WP_001185741.1.100824 WP_001185741.1.100836 WP_001185741.1.100851 WP_001185741.1.100852 WP_001185741.1.100867 WP_001185741.1.100868 WP_001185741.1.100928 WP_001185741.1.100933 WP_001185741.1.100990 WP_001185741.1.101033 WP_001185741.1.101096 WP_001185741.1.101102 WP_001185741.1.101121 WP_001185741.1.101157 WP_001185741.1.101175 WP_001185741.1.101186 WP_001185741.1.101214 WP_001185741.1.101216 WP_001185741.1.101255 WP_001185741.1.101257 WP_001185741.1.10126 WP_001185741.1.101289 WP_001185741.1.101293 WP_001185741.1.101313 WP_001185741.1.101418 WP_001185741.1.101436 WP_001185741.1.101468 WP_001185741.1.101486 WP_001185741.1.101518 WP_001185741.1.101522 WP_001185741.1.10154 WP_001185741.1.101545 WP_001185741.1.101583 WP_001185741.1.101594 WP_001185741.1.101630 WP_001185741.1.101651 WP_001185741.1.101653 WP_001185741.1.101667 WP_001185741.1.101686 WP_001185741.1.10173 WP_001185741.1.101747 WP_001185741.1.101786 WP_001185741.1.101822 WP_001185741.1.10184 WP_001185741.1.101840 WP_001185741.1.101865 WP_001185741.1.10188 WP_001185741.1.101887 WP_001185741.1.101889 WP_001185741.1.10190 WP_001185741.1.101900 WP_001185741.1.101913 WP_001185741.1.101937 WP_001185741.1.101940 WP_001185741.1.101942 WP_001185741.1.101947 WP_001185741.1.101952 WP_001185741.1.101964 WP_001185741.1.101969 WP_001185741.1.101987 WP_001185741.1.102021 WP_001185741.1.102069 WP_001185741.1.102093 WP_001185741.1.102122 WP_001185741.1.10222 WP_001185741.1.10304 WP_001185741.1.10329 WP_001185741.1.10348 WP_001185741.1.10352 WP_001185741.1.10361 WP_001185741.1.10379 WP_001185741.1.10400 WP_001185741.1.10461 WP_001185741.1.10491 WP_001185741.1.10508 WP_001185741.1.10525 WP_001185741.1.10538 WP_001185741.1.10576 WP_001185741.1.10579 WP_001185741.1.1058 WP_001185741.1.10607 WP_001185741.1.10628 WP_001185741.1.10651 WP_001185741.1.1071 WP_001185741.1.10715 WP_001185741.1.10729 WP_001185741.1.1073 WP_001185741.1.1074 WP_001185741.1.10763 WP_001185741.1.10771 WP_001185741.1.10798 WP_001185741.1.10862 WP_001185741.1.10922 WP_001185741.1.10940 WP_001185741.1.10988 WP_001185741.1.10994 WP_001185741.1.10995 WP_001185741.1.11006 WP_001185741.1.11032 WP_001185741.1.11071 WP_001185741.1.11121 WP_001185741.1.1113 WP_001185741.1.11133 WP_001185741.1.1122 WP_001185741.1.11251 WP_001185741.1.11272 WP_001185741.1.11323 WP_001185741.1.11440 WP_001185741.1.11452 WP_001185741.1.11499 WP_001185741.1.11524 WP_001185741.1.11578 WP_001185741.1.11595 WP_001185741.1.11616 WP_001185741.1.11645 WP_001185741.1.11673 WP_001185741.1.11699 WP_001185741.1.11759 WP_001185741.1.1176 WP_001185741.1.11762 WP_001185741.1.1186 WP_001185741.1.11912 WP_001185741.1.11949 WP_001185741.1.11955 WP_001185741.1.11985 WP_001185741.1.12000 WP_001185741.1.12036 WP_001185741.1.12051 WP_001185741.1.12095 WP_001185741.1.12112 WP_001185741.1.1218 WP_001185741.1.12204 WP_001185741.1.12279 WP_001185741.1.12292 WP_001185741.1.12320 WP_001185741.1.12342 WP_001185741.1.12415 WP_001185741.1.12426 WP_001185741.1.12478 WP_001185741.1.12542 WP_001185741.1.12558 WP_001185741.1.12582 WP_001185741.1.12623 WP_001185741.1.12645 WP_001185741.1.12693 WP_001185741.1.12743 WP_001185741.1.12749 WP_001185741.1.1275 WP_001185741.1.12781 WP_001185741.1.1280 WP_001185741.1.12876 WP_001185741.1.12914 WP_001185741.1.1295 WP_001185741.1.12965 WP_001185741.1.12979 WP_001185741.1.12987 WP_001185741.1.13015 WP_001185741.1.13074 WP_001185741.1.1315 WP_001185741.1.13157 WP_001185741.1.13162 WP_001185741.1.13239 WP_001185741.1.13278 WP_001185741.1.13281 WP_001185741.1.13290 WP_001185741.1.13301 WP_001185741.1.13346 WP_001185741.1.1335 WP_001185741.1.13383 WP_001185741.1.13411 WP_001185741.1.13437 WP_001185741.1.1345 WP_001185741.1.13492 WP_001185741.1.13495 WP_001185741.1.13525 WP_001185741.1.13566 WP_001185741.1.13585 WP_001185741.1.13589 WP_001185741.1.13601 WP_001185741.1.13618 WP_001185741.1.13624 WP_001185741.1.13740 WP_001185741.1.13791 WP_001185741.1.13877 WP_001185741.1.13891 WP_001185741.1.13944 WP_001185741.1.13949 WP_001185741.1.14058 WP_001185741.1.14062 WP_001185741.1.14094 WP_001185741.1.14127 WP_001185741.1.14154 WP_001185741.1.1419 WP_001185741.1.142 WP_001185741.1.14299 WP_001185741.1.14304 WP_001185741.1.1439 WP_001185741.1.14398 WP_001185741.1.14417 WP_001185741.1.14432 WP_001185741.1.14451 WP_001185741.1.14468 WP_001185741.1.14493 WP_001185741.1.14499 WP_001185741.1.14501 WP_001185741.1.14529 WP_001185741.1.14536 WP_001185741.1.14582 WP_001185741.1.14600 WP_001185741.1.1461 WP_001185741.1.14648 WP_001185741.1.14672 WP_001185741.1.14678 WP_001185741.1.14693 WP_001185741.1.14711 WP_001185741.1.1486 WP_001185741.1.14861 WP_001185741.1.14871 WP_001185741.1.14879 WP_001185741.1.14956 WP_001185741.1.14958 WP_001185741.1.14965 WP_001185741.1.14977 WP_001185741.1.14992 WP_001185741.1.14993 WP_001185741.1.15007 WP_001185741.1.15041 WP_001185741.1.1508 WP_001185741.1.15121 WP_001185741.1.15138 WP_001185741.1.15148 WP_001185741.1.15177 WP_001185741.1.15191 WP_001185741.1.1524 WP_001185741.1.15245 WP_001185741.1.15252 WP_001185741.1.15270 WP_001185741.1.15282 WP_001185741.1.15287 WP_001185741.1.15300 WP_001185741.1.15335 WP_001185741.1.15377 WP_001185741.1.1543 WP_001185741.1.15444 WP_001185741.1.15496 WP_001185741.1.15528 WP_001185741.1.15565 WP_001185741.1.15576 WP_001185741.1.15583 WP_001185741.1.15593 WP_001185741.1.1561 WP_001185741.1.15620 WP_001185741.1.15645 WP_001185741.1.15707 WP_001185741.1.15747 WP_001185741.1.15762 WP_001185741.1.15771 WP_001185741.1.15791 WP_001185741.1.1580 WP_001185741.1.15809 WP_001185741.1.1582 WP_001185741.1.15894 WP_001185741.1.15916 WP_001185741.1.15945 WP_001185741.1.15983 WP_001185741.1.16015 WP_001185741.1.16042 WP_001185741.1.16086 WP_001185741.1.16087 WP_001185741.1.1609 WP_001185741.1.16111 WP_001185741.1.16154 WP_001185741.1.16171 WP_001185741.1.16179 WP_001185741.1.16183 WP_001185741.1.16188 WP_001185741.1.16194 WP_001185741.1.1621 WP_001185741.1.16294 WP_001185741.1.163 WP_001185741.1.16303 WP_001185741.1.16388 WP_001185741.1.1640 WP_001185741.1.16482 WP_001185741.1.16517 WP_001185741.1.16532 WP_001185741.1.16541 WP_001185741.1.16592 WP_001185741.1.16604 WP_001185741.1.16640 WP_001185741.1.16648 WP_001185741.1.16669 WP_001185741.1.16715 WP_001185741.1.1673 WP_001185741.1.16745 WP_001185741.1.16752 WP_001185741.1.16805 WP_001185741.1.16861 WP_001185741.1.16894 WP_001185741.1.16970 WP_001185741.1.16992 WP_001185741.1.17042 WP_001185741.1.17084 WP_001185741.1.17085 WP_001185741.1.17087 WP_001185741.1.17089 WP_001185741.1.1710 WP_001185741.1.17101 WP_001185741.1.17109 WP_001185741.1.17111 WP_001185741.1.17182 WP_001185741.1.17186 WP_001185741.1.17205 WP_001185741.1.17230 WP_001185741.1.17241 WP_001185741.1.17242 WP_001185741.1.17267 WP_001185741.1.17297 WP_001185741.1.17300 WP_001185741.1.17301 WP_001185741.1.17356 WP_001185741.1.17373 WP_001185741.1.17389 WP_001185741.1.17392 WP_001185741.1.17403 WP_001185741.1.17410 WP_001185741.1.17417 WP_001185741.1.17441 WP_001185741.1.17464 WP_001185741.1.17550 WP_001185741.1.17570 WP_001185741.1.17577 WP_001185741.1.17623 WP_001185741.1.1763 WP_001185741.1.17637 WP_001185741.1.1766 WP_001185741.1.17680 WP_001185741.1.1769 WP_001185741.1.17711 WP_001185741.1.17765 WP_001185741.1.17766 WP_001185741.1.1778 WP_001185741.1.17802 WP_001185741.1.17829 WP_001185741.1.17836 WP_001185741.1.17952 WP_001185741.1.17963 WP_001185741.1.17984 WP_001185741.1.18000 WP_001185741.1.18006 WP_001185741.1.18094 WP_001185741.1.18121 WP_001185741.1.18134 WP_001185741.1.18164 WP_001185741.1.18175 WP_001185741.1.18226 WP_001185741.1.18311 WP_001185741.1.18338 WP_001185741.1.18381 WP_001185741.1.18402 WP_001185741.1.18436 WP_001185741.1.18438 WP_001185741.1.18458 WP_001185741.1.18511 WP_001185741.1.18583 WP_001185741.1.18628 WP_001185741.1.18666 WP_001185741.1.1867 WP_001185741.1.18675 WP_001185741.1.18714 WP_001185741.1.18806 WP_001185741.1.18861 WP_001185741.1.18874 WP_001185741.1.18923 WP_001185741.1.18929 WP_001185741.1.18936 WP_001185741.1.18983 WP_001185741.1.19024 WP_001185741.1.1903 WP_001185741.1.19090 WP_001185741.1.19100 WP_001185741.1.19113 WP_001185741.1.19114 WP_001185741.1.19122 WP_001185741.1.1915 WP_001185741.1.19194 WP_001185741.1.19205 WP_001185741.1.1925 WP_001185741.1.19297 WP_001185741.1.19312 WP_001185741.1.19313 WP_001185741.1.19314 WP_001185741.1.19315 WP_001185741.1.19332 WP_001185741.1.19338 WP_001185741.1.19347 WP_001185741.1.19389 WP_001185741.1.19397 WP_001185741.1.19424 WP_001185741.1.19448 WP_001185741.1.19453 WP_001185741.1.19478 WP_001185741.1.19487 WP_001185741.1.19494 WP_001185741.1.19544 WP_001185741.1.19557 WP_001185741.1.19583 WP_001185741.1.19602 WP_001185741.1.19758 WP_001185741.1.1982 WP_001185741.1.19838 WP_001185741.1.19845 WP_001185741.1.19873 WP_001185741.1.19940 WP_001185741.1.19945 WP_001185741.1.19957 WP_001185741.1.20025 WP_001185741.1.20096 WP_001185741.1.20114 WP_001185741.1.20129 WP_001185741.1.20157 WP_001185741.1.20164 WP_001185741.1.20178 WP_001185741.1.20183 WP_001185741.1.20192 WP_001185741.1.20215 WP_001185741.1.2022 WP_001185741.1.20230 WP_001185741.1.20251 WP_001185741.1.20290 WP_001185741.1.20325 WP_001185741.1.20334 WP_001185741.1.20370 WP_001185741.1.20483 WP_001185741.1.20484 WP_001185741.1.20519 WP_001185741.1.20596 WP_001185741.1.2063 WP_001185741.1.20636 WP_001185741.1.20638 WP_001185741.1.20662 WP_001185741.1.20668 WP_001185741.1.20724 WP_001185741.1.20730 WP_001185741.1.20737 WP_001185741.1.20785 WP_001185741.1.20813 WP_001185741.1.20824 WP_001185741.1.20831 WP_001185741.1.20848 WP_001185741.1.2093 WP_001185741.1.2094 WP_001185741.1.2100 WP_001185741.1.21020 WP_001185741.1.21022 WP_001185741.1.21041 WP_001185741.1.21057 WP_001185741.1.21059 WP_001185741.1.21129 WP_001185741.1.2113 WP_001185741.1.21131 WP_001185741.1.21137 WP_001185741.1.21171 WP_001185741.1.21277 WP_001185741.1.21305 WP_001185741.1.21320 WP_001185741.1.21336 WP_001185741.1.21441 WP_001185741.1.21470 WP_001185741.1.21519 WP_001185741.1.2156 WP_001185741.1.21573 WP_001185741.1.21578 WP_001185741.1.21596 WP_001185741.1.21637 WP_001185741.1.2164 WP_001185741.1.21656 WP_001185741.1.21667 WP_001185741.1.21673 WP_001185741.1.21696 WP_001185741.1.21727 WP_001185741.1.21732 WP_001185741.1.21733 WP_001185741.1.21758 WP_001185741.1.21762 WP_001185741.1.21771 WP_001185741.1.21811 WP_001185741.1.21812 WP_001185741.1.21887 WP_001185741.1.21895 WP_001185741.1.21915 WP_001185741.1.21948 WP_001185741.1.22060 WP_001185741.1.22113 WP_001185741.1.22195 WP_001185741.1.22204 WP_001185741.1.22268 WP_001185741.1.22291 WP_001185741.1.22295 WP_001185741.1.2232 WP_001185741.1.22325 WP_001185741.1.22328 WP_001185741.1.22350 WP_001185741.1.22409 WP_001185741.1.22470 WP_001185741.1.22501 WP_001185741.1.22522 WP_001185741.1.22544 WP_001185741.1.22571 WP_001185741.1.22572 WP_001185741.1.22641 WP_001185741.1.22685 WP_001185741.1.22756 WP_001185741.1.22771 WP_001185741.1.22777 WP_001185741.1.22783 WP_001185741.1.22809 WP_001185741.1.22827 WP_001185741.1.22830 WP_001185741.1.22868 WP_001185741.1.22875 WP_001185741.1.22878 WP_001185741.1.22885 WP_001185741.1.22896 WP_001185741.1.22908 WP_001185741.1.22961 WP_001185741.1.22990 WP_001185741.1.23005 WP_001185741.1.23026 WP_001185741.1.23035 WP_001185741.1.23044 WP_001185741.1.23045 WP_001185741.1.23057 WP_001185741.1.23062 WP_001185741.1.23078 WP_001185741.1.23081 WP_001185741.1.23090 WP_001185741.1.23092 WP_001185741.1.23105 WP_001185741.1.23120 WP_001185741.1.23135 WP_001185741.1.23257 WP_001185741.1.23270 WP_001185741.1.23285 WP_001185741.1.23290 WP_001185741.1.23293 WP_001185741.1.23352 WP_001185741.1.23378 WP_001185741.1.23443 WP_001185741.1.23456 WP_001185741.1.23486 WP_001185741.1.23487 WP_001185741.1.23511 WP_001185741.1.23520 WP_001185741.1.23527 WP_001185741.1.2353 WP_001185741.1.23554 WP_001185741.1.23561 WP_001185741.1.23563 WP_001185741.1.23584 WP_001185741.1.23622 WP_001185741.1.23640 WP_001185741.1.23660 WP_001185741.1.23693 WP_001185741.1.23729 WP_001185741.1.23741 WP_001185741.1.23754 WP_001185741.1.23765 WP_001185741.1.23795 WP_001185741.1.23812 WP_001185741.1.23881 WP_001185741.1.23886 WP_001185741.1.23898 WP_001185741.1.23914 WP_001185741.1.23915 WP_001185741.1.23931 WP_001185741.1.23945 WP_001185741.1.2395 WP_001185741.1.23950 WP_001185741.1.23971 WP_001185741.1.24 WP_001185741.1.24024 WP_001185741.1.24051 WP_001185741.1.24058 WP_001185741.1.24120 WP_001185741.1.24194 WP_001185741.1.2428 WP_001185741.1.24290 WP_001185741.1.24304 WP_001185741.1.2433 WP_001185741.1.2437 WP_001185741.1.24374 WP_001185741.1.24381 WP_001185741.1.24383 WP_001185741.1.24460 WP_001185741.1.24473 WP_001185741.1.24483 WP_001185741.1.24485 WP_001185741.1.24533 WP_001185741.1.24536 WP_001185741.1.24547 WP_001185741.1.2456 WP_001185741.1.24560 WP_001185741.1.24570 WP_001185741.1.24641 WP_001185741.1.24642 WP_001185741.1.24646 WP_001185741.1.24650 WP_001185741.1.24693 WP_001185741.1.24695 WP_001185741.1.24783 WP_001185741.1.2479 WP_001185741.1.24791 WP_001185741.1.24799 WP_001185741.1.24849 WP_001185741.1.24929 WP_001185741.1.24939 WP_001185741.1.24946 WP_001185741.1.24960 WP_001185741.1.24981 WP_001185741.1.24982 WP_001185741.1.24984 WP_001185741.1.25019 WP_001185741.1.25038 WP_001185741.1.25039 WP_001185741.1.2504 WP_001185741.1.25050 WP_001185741.1.25060 WP_001185741.1.25085 WP_001185741.1.25087 WP_001185741.1.25183 WP_001185741.1.25203 WP_001185741.1.25289 WP_001185741.1.25346 WP_001185741.1.2537 WP_001185741.1.25378 WP_001185741.1.254 WP_001185741.1.25403 WP_001185741.1.2543 WP_001185741.1.255 WP_001185741.1.25517 WP_001185741.1.25548 WP_001185741.1.25592 WP_001185741.1.25598 WP_001185741.1.25602 WP_001185741.1.25613 WP_001185741.1.25631 WP_001185741.1.25652 WP_001185741.1.25717 WP_001185741.1.25718 WP_001185741.1.25726 WP_001185741.1.25753 WP_001185741.1.25755 WP_001185741.1.25799 WP_001185741.1.25855 WP_001185741.1.25886 WP_001185741.1.2589 WP_001185741.1.25915 WP_001185741.1.25945 WP_001185741.1.25996 WP_001185741.1.26005 WP_001185741.1.26055 WP_001185741.1.26061 WP_001185741.1.26100 WP_001185741.1.2612 WP_001185741.1.26130 WP_001185741.1.26135 WP_001185741.1.26161 WP_001185741.1.26186 WP_001185741.1.26191 WP_001185741.1.26325 WP_001185741.1.26331 WP_001185741.1.2637 WP_001185741.1.26391 WP_001185741.1.26401 WP_001185741.1.26403 WP_001185741.1.26467 WP_001185741.1.26479 WP_001185741.1.26480 WP_001185741.1.26569 WP_001185741.1.26570 WP_001185741.1.26575 WP_001185741.1.26598 WP_001185741.1.26644 WP_001185741.1.26658 WP_001185741.1.26683 WP_001185741.1.26716 WP_001185741.1.26766 WP_001185741.1.26912 WP_001185741.1.26941 WP_001185741.1.27019 WP_001185741.1.2712 WP_001185741.1.27148 WP_001185741.1.27175 WP_001185741.1.27234 WP_001185741.1.27280 WP_001185741.1.27283 WP_001185741.1.27287 WP_001185741.1.2731 WP_001185741.1.27310 WP_001185741.1.27330 WP_001185741.1.27367 WP_001185741.1.27424 WP_001185741.1.27451 WP_001185741.1.27472 WP_001185741.1.27504 WP_001185741.1.27524 WP_001185741.1.27560 WP_001185741.1.27683 WP_001185741.1.27698 WP_001185741.1.27723 WP_001185741.1.27741 WP_001185741.1.27742 WP_001185741.1.27749 WP_001185741.1.27758 WP_001185741.1.27786 WP_001185741.1.27876 WP_001185741.1.27879 WP_001185741.1.27897 WP_001185741.1.27923 WP_001185741.1.27957 WP_001185741.1.27971 WP_001185741.1.28110 WP_001185741.1.28168 WP_001185741.1.28250 WP_001185741.1.2826 WP_001185741.1.28305 WP_001185741.1.28401 WP_001185741.1.28414 WP_001185741.1.28433 WP_001185741.1.28440 WP_001185741.1.28491 WP_001185741.1.28496 WP_001185741.1.28540 WP_001185741.1.28554 WP_001185741.1.28662 WP_001185741.1.28697 WP_001185741.1.28762 WP_001185741.1.28769 WP_001185741.1.28791 WP_001185741.1.28809 WP_001185741.1.2881 WP_001185741.1.28835 WP_001185741.1.28953 WP_001185741.1.290 WP_001185741.1.29001 WP_001185741.1.29013 WP_001185741.1.29026 WP_001185741.1.29055 WP_001185741.1.29079 WP_001185741.1.29082 WP_001185741.1.29100 WP_001185741.1.29118 WP_001185741.1.29125 WP_001185741.1.29128 WP_001185741.1.29146 WP_001185741.1.29176 WP_001185741.1.29194 WP_001185741.1.29197 WP_001185741.1.29206 WP_001185741.1.29221 WP_001185741.1.29252 WP_001185741.1.2931 WP_001185741.1.29495 WP_001185741.1.29503 WP_001185741.1.29504 WP_001185741.1.2954 WP_001185741.1.29556 WP_001185741.1.29590 WP_001185741.1.29643 WP_001185741.1.29669 WP_001185741.1.29683 WP_001185741.1.29699 WP_001185741.1.29724 WP_001185741.1.29740 WP_001185741.1.29746 WP_001185741.1.29752 WP_001185741.1.29798 WP_001185741.1.29812 WP_001185741.1.29840 WP_001185741.1.2986 WP_001185741.1.29874 WP_001185741.1.29876 WP_001185741.1.29933 WP_001185741.1.29992 WP_001185741.1.30035 WP_001185741.1.30098 WP_001185741.1.30105 WP_001185741.1.30123 WP_001185741.1.30141 WP_001185741.1.30221 WP_001185741.1.30231 WP_001185741.1.30347 WP_001185741.1.30391 WP_001185741.1.30399 WP_001185741.1.30401 WP_001185741.1.30452 WP_001185741.1.30580 WP_001185741.1.3063 WP_001185741.1.30639 WP_001185741.1.30640 WP_001185741.1.30700 WP_001185741.1.30733 WP_001185741.1.30742 WP_001185741.1.30843 WP_001185741.1.30853 WP_001185741.1.30906 WP_001185741.1.30960 WP_001185741.1.31009 WP_001185741.1.31026 WP_001185741.1.31089 WP_001185741.1.31142 WP_001185741.1.31211 WP_001185741.1.31319 WP_001185741.1.31340 WP_001185741.1.31347 WP_001185741.1.31353 WP_001185741.1.31357 WP_001185741.1.31407 WP_001185741.1.31419 WP_001185741.1.31429 WP_001185741.1.31431 WP_001185741.1.31434 WP_001185741.1.31482 WP_001185741.1.31518 WP_001185741.1.31521 WP_001185741.1.31527 WP_001185741.1.31614 WP_001185741.1.31618 WP_001185741.1.31625 WP_001185741.1.31639 WP_001185741.1.31679 WP_001185741.1.31681 WP_001185741.1.3169 WP_001185741.1.31696 WP_001185741.1.31709 WP_001185741.1.31736 WP_001185741.1.3176 WP_001185741.1.31801 WP_001185741.1.31803 WP_001185741.1.3181 WP_001185741.1.31839 WP_001185741.1.31860 WP_001185741.1.31866 WP_001185741.1.31899 WP_001185741.1.31903 WP_001185741.1.31924 WP_001185741.1.31978 WP_001185741.1.32020 WP_001185741.1.32049 WP_001185741.1.32078 WP_001185741.1.32089 WP_001185741.1.32091 WP_001185741.1.32093 WP_001185741.1.32121 WP_001185741.1.32127 WP_001185741.1.32142 WP_001185741.1.3215 WP_001185741.1.32173 WP_001185741.1.32234 WP_001185741.1.32242 WP_001185741.1.32279 WP_001185741.1.32287 WP_001185741.1.32333 WP_001185741.1.32406 WP_001185741.1.32435 WP_001185741.1.32448 WP_001185741.1.3247 WP_001185741.1.32475 WP_001185741.1.32479 WP_001185741.1.32509 WP_001185741.1.32561 WP_001185741.1.32580 WP_001185741.1.32591 WP_001185741.1.32601 WP_001185741.1.32635 WP_001185741.1.32680 WP_001185741.1.327 WP_001185741.1.32709 WP_001185741.1.32715 WP_001185741.1.32720 WP_001185741.1.32724 WP_001185741.1.32741 WP_001185741.1.32811 WP_001185741.1.32831 WP_001185741.1.32910 WP_001185741.1.32946 WP_001185741.1.32959 WP_001185741.1.32972 WP_001185741.1.32984 WP_001185741.1.32992 WP_001185741.1.32995 WP_001185741.1.33014 WP_001185741.1.33022 WP_001185741.1.33053 WP_001185741.1.33119 WP_001185741.1.33171 WP_001185741.1.3323 WP_001185741.1.33237 WP_001185741.1.33244 WP_001185741.1.33325 WP_001185741.1.33362 WP_001185741.1.33408 WP_001185741.1.33413 WP_001185741.1.33422 WP_001185741.1.33424 WP_001185741.1.33475 WP_001185741.1.33502 WP_001185741.1.33512 WP_001185741.1.3354 WP_001185741.1.33561 WP_001185741.1.33595 WP_001185741.1.33638 WP_001185741.1.33680 WP_001185741.1.33729 WP_001185741.1.33745 WP_001185741.1.33746 WP_001185741.1.33823 WP_001185741.1.33853 WP_001185741.1.33888 WP_001185741.1.33952 WP_001185741.1.33973 WP_001185741.1.33979 WP_001185741.1.3398 WP_001185741.1.34003 WP_001185741.1.34032 WP_001185741.1.34094 WP_001185741.1.3411 WP_001185741.1.34122 WP_001185741.1.34124 WP_001185741.1.3415 WP_001185741.1.34206 WP_001185741.1.34273 WP_001185741.1.34380 WP_001185741.1.34397 WP_001185741.1.3444 WP_001185741.1.34440 WP_001185741.1.34444 WP_001185741.1.34464 WP_001185741.1.34532 WP_001185741.1.34538 WP_001185741.1.34541 WP_001185741.1.34557 WP_001185741.1.34605 WP_001185741.1.34655 WP_001185741.1.34668 WP_001185741.1.34682 WP_001185741.1.34727 WP_001185741.1.34781 WP_001185741.1.34782 WP_001185741.1.34794 WP_001185741.1.34827 WP_001185741.1.34855 WP_001185741.1.34948 WP_001185741.1.34983 WP_001185741.1.35006 WP_001185741.1.35186 WP_001185741.1.35202 WP_001185741.1.3521 WP_001185741.1.35211 WP_001185741.1.35316 WP_001185741.1.35360 WP_001185741.1.35368 WP_001185741.1.35376 WP_001185741.1.3539 WP_001185741.1.35398 WP_001185741.1.35464 WP_001185741.1.35552 WP_001185741.1.35581 WP_001185741.1.3560 WP_001185741.1.35649 WP_001185741.1.35653 WP_001185741.1.35654 WP_001185741.1.35698 WP_001185741.1.35724 WP_001185741.1.35922 WP_001185741.1.35927 WP_001185741.1.35934 WP_001185741.1.35942 WP_001185741.1.35959 WP_001185741.1.35983 WP_001185741.1.36040 WP_001185741.1.36070 WP_001185741.1.36071 WP_001185741.1.36085 WP_001185741.1.36129 WP_001185741.1.36159 WP_001185741.1.36166 WP_001185741.1.36182 WP_001185741.1.3620 WP_001185741.1.36281 WP_001185741.1.36299 WP_001185741.1.36393 WP_001185741.1.36412 WP_001185741.1.36426 WP_001185741.1.36453 WP_001185741.1.36496 WP_001185741.1.36500 WP_001185741.1.36507 WP_001185741.1.36523 WP_001185741.1.36537 WP_001185741.1.36610 WP_001185741.1.36627 WP_001185741.1.36628 WP_001185741.1.36707 WP_001185741.1.36746 WP_001185741.1.36806 WP_001185741.1.36971 WP_001185741.1.37006 WP_001185741.1.37020 WP_001185741.1.37046 WP_001185741.1.37076 WP_001185741.1.37101 WP_001185741.1.37122 WP_001185741.1.37146 WP_001185741.1.37155 WP_001185741.1.37206 WP_001185741.1.37252 WP_001185741.1.37261 WP_001185741.1.3730 WP_001185741.1.37329 WP_001185741.1.37334 WP_001185741.1.37419 WP_001185741.1.37445 WP_001185741.1.37476 WP_001185741.1.37485 WP_001185741.1.3749 WP_001185741.1.37510 WP_001185741.1.37543 WP_001185741.1.37549 WP_001185741.1.37554 WP_001185741.1.37576 WP_001185741.1.37588 WP_001185741.1.37634 WP_001185741.1.37637 WP_001185741.1.377 WP_001185741.1.3772 WP_001185741.1.37730 WP_001185741.1.37750 WP_001185741.1.37762 WP_001185741.1.37773 WP_001185741.1.37852 WP_001185741.1.37887 WP_001185741.1.37917 WP_001185741.1.37926 WP_001185741.1.37940 WP_001185741.1.37995 WP_001185741.1.38033 WP_001185741.1.38081 WP_001185741.1.38103 WP_001185741.1.38105 WP_001185741.1.38119 WP_001185741.1.38162 WP_001185741.1.38202 WP_001185741.1.38257 WP_001185741.1.38264 WP_001185741.1.38314 WP_001185741.1.38323 WP_001185741.1.38357 WP_001185741.1.38371 WP_001185741.1.38412 WP_001185741.1.38419 WP_001185741.1.38485 WP_001185741.1.38584 WP_001185741.1.38610 WP_001185741.1.38626 WP_001185741.1.38629 WP_001185741.1.38636 WP_001185741.1.38694 WP_001185741.1.3873 WP_001185741.1.38811 WP_001185741.1.38827 WP_001185741.1.38843 WP_001185741.1.38911 WP_001185741.1.38920 WP_001185741.1.38935 WP_001185741.1.38950 WP_001185741.1.38956 WP_001185741.1.39005 WP_001185741.1.39015 WP_001185741.1.3903 WP_001185741.1.39037 WP_001185741.1.3904 WP_001185741.1.39042 WP_001185741.1.39063 WP_001185741.1.39103 WP_001185741.1.39111 WP_001185741.1.39123 WP_001185741.1.39155 WP_001185741.1.39157 WP_001185741.1.39164 WP_001185741.1.39171 WP_001185741.1.3921 WP_001185741.1.39249 WP_001185741.1.39305 WP_001185741.1.39342 WP_001185741.1.39358 WP_001185741.1.39365 WP_001185741.1.39373 WP_001185741.1.39430 WP_001185741.1.39468 WP_001185741.1.39481 WP_001185741.1.39509 WP_001185741.1.39531 WP_001185741.1.3954 WP_001185741.1.39580 WP_001185741.1.39606 WP_001185741.1.39607 WP_001185741.1.39610 WP_001185741.1.3970 WP_001185741.1.39715 WP_001185741.1.39730 WP_001185741.1.39758 WP_001185741.1.39780 WP_001185741.1.39818 WP_001185741.1.39822 WP_001185741.1.39998 WP_001185741.1.40121 WP_001185741.1.40147 WP_001185741.1.40159 WP_001185741.1.40183 WP_001185741.1.40192 WP_001185741.1.4020 WP_001185741.1.40206 WP_001185741.1.40238 WP_001185741.1.40315 WP_001185741.1.40317 WP_001185741.1.40319 WP_001185741.1.40335 WP_001185741.1.40382 WP_001185741.1.40389 WP_001185741.1.40391 WP_001185741.1.40403 WP_001185741.1.40445 WP_001185741.1.4049 WP_001185741.1.40509 WP_001185741.1.40524 WP_001185741.1.40548 WP_001185741.1.40596 WP_001185741.1.40599 WP_001185741.1.40623 WP_001185741.1.40668 WP_001185741.1.40781 WP_001185741.1.4081 WP_001185741.1.40813 WP_001185741.1.40815 WP_001185741.1.40865 WP_001185741.1.40912 WP_001185741.1.40937 WP_001185741.1.41037 WP_001185741.1.41045 WP_001185741.1.41125 WP_001185741.1.41147 WP_001185741.1.41230 WP_001185741.1.41244 WP_001185741.1.41259 WP_001185741.1.4126 WP_001185741.1.41263 WP_001185741.1.41315 WP_001185741.1.41339 WP_001185741.1.41368 WP_001185741.1.41371 WP_001185741.1.41372 WP_001185741.1.41391 WP_001185741.1.41392 WP_001185741.1.41407 WP_001185741.1.41417 WP_001185741.1.4142 WP_001185741.1.41436 WP_001185741.1.41449 WP_001185741.1.41455 WP_001185741.1.41457 WP_001185741.1.41466 WP_001185741.1.41513 WP_001185741.1.41545 WP_001185741.1.41566 WP_001185741.1.41606 WP_001185741.1.41613 WP_001185741.1.41621 WP_001185741.1.41651 WP_001185741.1.41712 WP_001185741.1.41718 WP_001185741.1.4172 WP_001185741.1.41740 WP_001185741.1.41778 WP_001185741.1.41812 WP_001185741.1.41988 WP_001185741.1.42027 WP_001185741.1.42033 WP_001185741.1.42038 WP_001185741.1.42060 WP_001185741.1.42095 WP_001185741.1.42096 WP_001185741.1.42179 WP_001185741.1.42203 WP_001185741.1.42226 WP_001185741.1.42233 WP_001185741.1.4224 WP_001185741.1.42252 WP_001185741.1.42277 WP_001185741.1.42284 WP_001185741.1.42300 WP_001185741.1.42359 WP_001185741.1.42367 WP_001185741.1.42369 WP_001185741.1.42387 WP_001185741.1.4242 WP_001185741.1.42442 WP_001185741.1.42448 WP_001185741.1.42480 WP_001185741.1.42522 WP_001185741.1.42661 WP_001185741.1.42669 WP_001185741.1.42728 WP_001185741.1.42748 WP_001185741.1.42749 WP_001185741.1.42750 WP_001185741.1.42761 WP_001185741.1.42770 WP_001185741.1.42791 WP_001185741.1.42813 WP_001185741.1.4282 WP_001185741.1.42828 WP_001185741.1.42830 WP_001185741.1.42832 WP_001185741.1.42918 WP_001185741.1.42937 WP_001185741.1.42950 WP_001185741.1.42962 WP_001185741.1.42966 WP_001185741.1.42987 WP_001185741.1.43035 WP_001185741.1.43132 WP_001185741.1.43166 WP_001185741.1.43239 WP_001185741.1.43270 WP_001185741.1.43316 WP_001185741.1.43324 WP_001185741.1.43363 WP_001185741.1.43374 WP_001185741.1.43389 WP_001185741.1.4342 WP_001185741.1.43473 WP_001185741.1.43489 WP_001185741.1.43561 WP_001185741.1.43566 WP_001185741.1.43642 WP_001185741.1.43720 WP_001185741.1.43750 WP_001185741.1.43858 WP_001185741.1.43925 WP_001185741.1.4400 WP_001185741.1.44018 WP_001185741.1.44020 WP_001185741.1.44040 WP_001185741.1.44077 WP_001185741.1.44088 WP_001185741.1.4411 WP_001185741.1.44115 WP_001185741.1.4415 WP_001185741.1.44162 WP_001185741.1.44222 WP_001185741.1.44264 WP_001185741.1.44273 WP_001185741.1.44285 WP_001185741.1.44287 WP_001185741.1.44314 WP_001185741.1.44365 WP_001185741.1.44424 WP_001185741.1.44426 WP_001185741.1.44445 WP_001185741.1.4445 WP_001185741.1.44458 WP_001185741.1.44461 WP_001185741.1.44539 WP_001185741.1.44558 WP_001185741.1.44627 WP_001185741.1.44661 WP_001185741.1.44671 WP_001185741.1.44686 WP_001185741.1.44724 WP_001185741.1.44756 WP_001185741.1.448 WP_001185741.1.44814 WP_001185741.1.44818 WP_001185741.1.44848 WP_001185741.1.44854 WP_001185741.1.44923 WP_001185741.1.44961 WP_001185741.1.45000 WP_001185741.1.45028 WP_001185741.1.45068 WP_001185741.1.45156 WP_001185741.1.4516 WP_001185741.1.45208 WP_001185741.1.4524 WP_001185741.1.45246 WP_001185741.1.4535 WP_001185741.1.45359 WP_001185741.1.45392 WP_001185741.1.45444 WP_001185741.1.4549 WP_001185741.1.45494 WP_001185741.1.45500 WP_001185741.1.45581 WP_001185741.1.45595 WP_001185741.1.45600 WP_001185741.1.4563 WP_001185741.1.45718 WP_001185741.1.45741 WP_001185741.1.45799 WP_001185741.1.45840 WP_001185741.1.45846 WP_001185741.1.45865 WP_001185741.1.45868 WP_001185741.1.45930 WP_001185741.1.45933 WP_001185741.1.45945 WP_001185741.1.45949 WP_001185741.1.45960 WP_001185741.1.45962 WP_001185741.1.45991 WP_001185741.1.4600 WP_001185741.1.46027 WP_001185741.1.46049 WP_001185741.1.46070 WP_001185741.1.46081 WP_001185741.1.46097 WP_001185741.1.46105 WP_001185741.1.46115 WP_001185741.1.4613 WP_001185741.1.4617 WP_001185741.1.46197 WP_001185741.1.46239 WP_001185741.1.46245 WP_001185741.1.46257 WP_001185741.1.46301 WP_001185741.1.46429 WP_001185741.1.4643 WP_001185741.1.46433 WP_001185741.1.4646 WP_001185741.1.46468 WP_001185741.1.46477 WP_001185741.1.46526 WP_001185741.1.46541 WP_001185741.1.46552 WP_001185741.1.46555 WP_001185741.1.46602 WP_001185741.1.46614 WP_001185741.1.46643 WP_001185741.1.46655 WP_001185741.1.46668 WP_001185741.1.46734 WP_001185741.1.46802 WP_001185741.1.46821 WP_001185741.1.46857 WP_001185741.1.46860 WP_001185741.1.46876 WP_001185741.1.46882 WP_001185741.1.46898 WP_001185741.1.46909 WP_001185741.1.4691 WP_001185741.1.46912 WP_001185741.1.46990 WP_001185741.1.47028 WP_001185741.1.47029 WP_001185741.1.47030 WP_001185741.1.47034 WP_001185741.1.47038 WP_001185741.1.47048 WP_001185741.1.47069 WP_001185741.1.47135 WP_001185741.1.47246 WP_001185741.1.47280 WP_001185741.1.47307 WP_001185741.1.47316 WP_001185741.1.47319 WP_001185741.1.47332 WP_001185741.1.47350 WP_001185741.1.47356 WP_001185741.1.47370 WP_001185741.1.47386 WP_001185741.1.47398 WP_001185741.1.4740 WP_001185741.1.47401 WP_001185741.1.47414 WP_001185741.1.47416 WP_001185741.1.47451 WP_001185741.1.47473 WP_001185741.1.47496 WP_001185741.1.47529 WP_001185741.1.47555 WP_001185741.1.47582 WP_001185741.1.47634 WP_001185741.1.47662 WP_001185741.1.4773 WP_001185741.1.47734 WP_001185741.1.47744 WP_001185741.1.47761 WP_001185741.1.47770 WP_001185741.1.47775 WP_001185741.1.47791 WP_001185741.1.47820 WP_001185741.1.47848 WP_001185741.1.4785 WP_001185741.1.47914 WP_001185741.1.47962 WP_001185741.1.47976 WP_001185741.1.47981 WP_001185741.1.47983 WP_001185741.1.48048 WP_001185741.1.48073 WP_001185741.1.48077 WP_001185741.1.48087 WP_001185741.1.48096 WP_001185741.1.48111 WP_001185741.1.48144 WP_001185741.1.48188 WP_001185741.1.48285 WP_001185741.1.48291 WP_001185741.1.48355 WP_001185741.1.48371 WP_001185741.1.48385 WP_001185741.1.48404 WP_001185741.1.48417 WP_001185741.1.48433 WP_001185741.1.48483 WP_001185741.1.48505 WP_001185741.1.48522 WP_001185741.1.48571 WP_001185741.1.48590 WP_001185741.1.486 WP_001185741.1.48602 WP_001185741.1.48615 WP_001185741.1.48678 WP_001185741.1.48771 WP_001185741.1.48801 WP_001185741.1.48825 WP_001185741.1.48901 WP_001185741.1.48907 WP_001185741.1.48921 WP_001185741.1.48928 WP_001185741.1.48954 WP_001185741.1.48974 WP_001185741.1.49107 WP_001185741.1.49136 WP_001185741.1.49147 WP_001185741.1.49190 WP_001185741.1.49229 WP_001185741.1.49243 WP_001185741.1.49259 WP_001185741.1.49312 WP_001185741.1.49336 WP_001185741.1.49431 WP_001185741.1.49459 WP_001185741.1.49481 WP_001185741.1.49482 WP_001185741.1.4949 WP_001185741.1.49528 WP_001185741.1.4953 WP_001185741.1.49531 WP_001185741.1.49546 WP_001185741.1.49599 WP_001185741.1.49684 WP_001185741.1.49712 WP_001185741.1.49722 WP_001185741.1.49740 WP_001185741.1.49747 WP_001185741.1.49768 WP_001185741.1.49777 WP_001185741.1.49823 WP_001185741.1.49856 WP_001185741.1.49861 WP_001185741.1.49879 WP_001185741.1.49902 WP_001185741.1.49950 WP_001185741.1.49987 WP_001185741.1.50006 WP_001185741.1.50036 WP_001185741.1.50078 WP_001185741.1.50098 WP_001185741.1.50113 WP_001185741.1.50119 WP_001185741.1.50136 WP_001185741.1.50182 WP_001185741.1.50196 WP_001185741.1.50207 WP_001185741.1.50230 WP_001185741.1.50258 WP_001185741.1.50269 WP_001185741.1.50273 WP_001185741.1.50329 WP_001185741.1.50353 WP_001185741.1.50361 WP_001185741.1.50366 WP_001185741.1.50381 WP_001185741.1.5040 WP_001185741.1.5041 WP_001185741.1.50412 WP_001185741.1.50446 WP_001185741.1.50452 WP_001185741.1.5046 WP_001185741.1.50539 WP_001185741.1.50548 WP_001185741.1.50586 WP_001185741.1.506 WP_001185741.1.5061 WP_001185741.1.5064 WP_001185741.1.50715 WP_001185741.1.50936 WP_001185741.1.50939 WP_001185741.1.5095 WP_001185741.1.50993 WP_001185741.1.50996 WP_001185741.1.51058 WP_001185741.1.51109 WP_001185741.1.51127 WP_001185741.1.51175 WP_001185741.1.51201 WP_001185741.1.51206 WP_001185741.1.51260 WP_001185741.1.51278 WP_001185741.1.5128 WP_001185741.1.51299 WP_001185741.1.51323 WP_001185741.1.51336 WP_001185741.1.51354 WP_001185741.1.51364 WP_001185741.1.51405 WP_001185741.1.51427 WP_001185741.1.51430 WP_001185741.1.51441 WP_001185741.1.5146 WP_001185741.1.51462 WP_001185741.1.51482 WP_001185741.1.51495 WP_001185741.1.51503 WP_001185741.1.51513 WP_001185741.1.51525 WP_001185741.1.51537 WP_001185741.1.51539 WP_001185741.1.51542 WP_001185741.1.51552 WP_001185741.1.51587 WP_001185741.1.51600 WP_001185741.1.51607 WP_001185741.1.51624 WP_001185741.1.51662 WP_001185741.1.51707 WP_001185741.1.51718 WP_001185741.1.5172 WP_001185741.1.51736 WP_001185741.1.51784 WP_001185741.1.51837 WP_001185741.1.51839 WP_001185741.1.51869 WP_001185741.1.51899 WP_001185741.1.51906 WP_001185741.1.51985 WP_001185741.1.51999 WP_001185741.1.52002 WP_001185741.1.52011 WP_001185741.1.52020 WP_001185741.1.52044 WP_001185741.1.52076 WP_001185741.1.52111 WP_001185741.1.52126 WP_001185741.1.52127 WP_001185741.1.52186 WP_001185741.1.52200 WP_001185741.1.52214 WP_001185741.1.52225 WP_001185741.1.52230 WP_001185741.1.52236 WP_001185741.1.52240 WP_001185741.1.52243 WP_001185741.1.52249 WP_001185741.1.5227 WP_001185741.1.52272 WP_001185741.1.52304 WP_001185741.1.52324 WP_001185741.1.52328 WP_001185741.1.52378 WP_001185741.1.5239 WP_001185741.1.52406 WP_001185741.1.52413 WP_001185741.1.52492 WP_001185741.1.52554 WP_001185741.1.52558 WP_001185741.1.52567 WP_001185741.1.52601 WP_001185741.1.52612 WP_001185741.1.52662 WP_001185741.1.52710 WP_001185741.1.52735 WP_001185741.1.52755 WP_001185741.1.52762 WP_001185741.1.52774 WP_001185741.1.52777 WP_001185741.1.52780 WP_001185741.1.52801 WP_001185741.1.52844 WP_001185741.1.52895 WP_001185741.1.52908 WP_001185741.1.5291 WP_001185741.1.52913 WP_001185741.1.52942 WP_001185741.1.52962 WP_001185741.1.52995 WP_001185741.1.52996 WP_001185741.1.53012 WP_001185741.1.53020 WP_001185741.1.53027 WP_001185741.1.53099 WP_001185741.1.5310 WP_001185741.1.53155 WP_001185741.1.53186 WP_001185741.1.53223 WP_001185741.1.53228 WP_001185741.1.53238 WP_001185741.1.53242 WP_001185741.1.53251 WP_001185741.1.53277 WP_001185741.1.53308 WP_001185741.1.53356 WP_001185741.1.53377 WP_001185741.1.53401 WP_001185741.1.53419 WP_001185741.1.53431 WP_001185741.1.53505 WP_001185741.1.5351 WP_001185741.1.53535 WP_001185741.1.53537 WP_001185741.1.53545 WP_001185741.1.53574 WP_001185741.1.53582 WP_001185741.1.53592 WP_001185741.1.5362 WP_001185741.1.53642 WP_001185741.1.53645 WP_001185741.1.53706 WP_001185741.1.53809 WP_001185741.1.53811 WP_001185741.1.53866 WP_001185741.1.53878 WP_001185741.1.5395 WP_001185741.1.53966 WP_001185741.1.53968 WP_001185741.1.53972 WP_001185741.1.53978 WP_001185741.1.53994 WP_001185741.1.54013 WP_001185741.1.54032 WP_001185741.1.54072 WP_001185741.1.54091 WP_001185741.1.54144 WP_001185741.1.54185 WP_001185741.1.54202 WP_001185741.1.54263 WP_001185741.1.54307 WP_001185741.1.54317 WP_001185741.1.5433 WP_001185741.1.54359 WP_001185741.1.5440 WP_001185741.1.54546 WP_001185741.1.54591 WP_001185741.1.5460 WP_001185741.1.54602 WP_001185741.1.54614 WP_001185741.1.54617 WP_001185741.1.54638 WP_001185741.1.54641 WP_001185741.1.54688 WP_001185741.1.54725 WP_001185741.1.54755 WP_001185741.1.5479 WP_001185741.1.54798 WP_001185741.1.54817 WP_001185741.1.54918 WP_001185741.1.54921 WP_001185741.1.54941 WP_001185741.1.54946 WP_001185741.1.54989 WP_001185741.1.54991 WP_001185741.1.55003 WP_001185741.1.55009 WP_001185741.1.55041 WP_001185741.1.55070 WP_001185741.1.55115 WP_001185741.1.55134 WP_001185741.1.55144 WP_001185741.1.55177 WP_001185741.1.5520 WP_001185741.1.55203 WP_001185741.1.55338 WP_001185741.1.55357 WP_001185741.1.55374 WP_001185741.1.55381 WP_001185741.1.55466 WP_001185741.1.55482 WP_001185741.1.55483 WP_001185741.1.55489 WP_001185741.1.55560 WP_001185741.1.55571 WP_001185741.1.55574 WP_001185741.1.55581 WP_001185741.1.55597 WP_001185741.1.55608 WP_001185741.1.55629 WP_001185741.1.5566 WP_001185741.1.5570 WP_001185741.1.55709 WP_001185741.1.55727 WP_001185741.1.55825 WP_001185741.1.55844 WP_001185741.1.55868 WP_001185741.1.55979 WP_001185741.1.55988 WP_001185741.1.561 WP_001185741.1.56101 WP_001185741.1.5614 WP_001185741.1.56177 WP_001185741.1.56193 WP_001185741.1.56216 WP_001185741.1.56231 WP_001185741.1.56302 WP_001185741.1.56345 WP_001185741.1.56358 WP_001185741.1.56371 WP_001185741.1.56388 WP_001185741.1.56390 WP_001185741.1.56399 WP_001185741.1.56446 WP_001185741.1.5646 WP_001185741.1.5649 WP_001185741.1.56528 WP_001185741.1.56543 WP_001185741.1.56573 WP_001185741.1.56680 WP_001185741.1.5670 WP_001185741.1.56704 WP_001185741.1.56713 WP_001185741.1.56721 WP_001185741.1.56742 WP_001185741.1.56776 WP_001185741.1.56777 WP_001185741.1.56787 WP_001185741.1.56799 WP_001185741.1.56830 WP_001185741.1.56835 WP_001185741.1.56846 WP_001185741.1.5685 WP_001185741.1.56871 WP_001185741.1.56882 WP_001185741.1.56908 WP_001185741.1.56932 WP_001185741.1.56934 WP_001185741.1.56937 WP_001185741.1.56951 WP_001185741.1.56992 WP_001185741.1.57072 WP_001185741.1.57100 WP_001185741.1.57124 WP_001185741.1.57150 WP_001185741.1.57216 WP_001185741.1.57222 WP_001185741.1.57254 WP_001185741.1.57269 WP_001185741.1.57319 WP_001185741.1.57348 WP_001185741.1.57395 WP_001185741.1.57403 WP_001185741.1.57414 WP_001185741.1.57487 WP_001185741.1.57538 WP_001185741.1.5755 WP_001185741.1.57558 WP_001185741.1.57574 WP_001185741.1.57588 WP_001185741.1.57628 WP_001185741.1.57629 WP_001185741.1.57634 WP_001185741.1.57659 WP_001185741.1.57663 WP_001185741.1.57812 WP_001185741.1.57846 WP_001185741.1.57898 WP_001185741.1.57903 WP_001185741.1.57920 WP_001185741.1.57951 WP_001185741.1.57975 WP_001185741.1.58022 WP_001185741.1.58045 WP_001185741.1.58080 WP_001185741.1.58128 WP_001185741.1.58136 WP_001185741.1.58143 WP_001185741.1.58146 WP_001185741.1.58163 WP_001185741.1.58172 WP_001185741.1.58206 WP_001185741.1.58226 WP_001185741.1.58232 WP_001185741.1.58267 WP_001185741.1.58316 WP_001185741.1.58368 WP_001185741.1.58371 WP_001185741.1.5842 WP_001185741.1.58420 WP_001185741.1.58429 WP_001185741.1.58440 WP_001185741.1.58445 WP_001185741.1.58484 WP_001185741.1.58496 WP_001185741.1.58514 WP_001185741.1.58572 WP_001185741.1.58582 WP_001185741.1.58622 WP_001185741.1.58680 WP_001185741.1.58870 WP_001185741.1.58942 WP_001185741.1.58951 WP_001185741.1.58958 WP_001185741.1.58976 WP_001185741.1.58977 WP_001185741.1.58983 WP_001185741.1.59026 WP_001185741.1.59035 WP_001185741.1.5906 WP_001185741.1.59083 WP_001185741.1.59119 WP_001185741.1.59165 WP_001185741.1.59190 WP_001185741.1.59199 WP_001185741.1.59218 WP_001185741.1.59226 WP_001185741.1.59280 WP_001185741.1.59293 WP_001185741.1.59302 WP_001185741.1.59306 WP_001185741.1.59395 WP_001185741.1.59396 WP_001185741.1.59407 WP_001185741.1.59409 WP_001185741.1.59413 WP_001185741.1.59423 WP_001185741.1.59434 WP_001185741.1.59615 WP_001185741.1.59621 WP_001185741.1.59638 WP_001185741.1.5965 WP_001185741.1.59689 WP_001185741.1.59699 WP_001185741.1.597 WP_001185741.1.59717 WP_001185741.1.59730 WP_001185741.1.59756 WP_001185741.1.59781 WP_001185741.1.59782 WP_001185741.1.59823 WP_001185741.1.59855 WP_001185741.1.5990 WP_001185741.1.59914 WP_001185741.1.59932 WP_001185741.1.60005 WP_001185741.1.6002 WP_001185741.1.60070 WP_001185741.1.60186 WP_001185741.1.6022 WP_001185741.1.60228 WP_001185741.1.60246 WP_001185741.1.60342 WP_001185741.1.60387 WP_001185741.1.60443 WP_001185741.1.60457 WP_001185741.1.60477 WP_001185741.1.60491 WP_001185741.1.60498 WP_001185741.1.60505 WP_001185741.1.60559 WP_001185741.1.60570 WP_001185741.1.6059 WP_001185741.1.60599 WP_001185741.1.60606 WP_001185741.1.60614 WP_001185741.1.6064 WP_001185741.1.60644 WP_001185741.1.6066 WP_001185741.1.60671 WP_001185741.1.60684 WP_001185741.1.60698 WP_001185741.1.60717 WP_001185741.1.60732 WP_001185741.1.60771 WP_001185741.1.60805 WP_001185741.1.60816 WP_001185741.1.60826 WP_001185741.1.60832 WP_001185741.1.60835 WP_001185741.1.60847 WP_001185741.1.60895 WP_001185741.1.60921 WP_001185741.1.60925 WP_001185741.1.60927 WP_001185741.1.6094 WP_001185741.1.60974 WP_001185741.1.61035 WP_001185741.1.61058 WP_001185741.1.6110 WP_001185741.1.61112 WP_001185741.1.61148 WP_001185741.1.61174 WP_001185741.1.61223 WP_001185741.1.61225 WP_001185741.1.61241 WP_001185741.1.61268 WP_001185741.1.61292 WP_001185741.1.61362 WP_001185741.1.61373 WP_001185741.1.61512 WP_001185741.1.61524 WP_001185741.1.61551 WP_001185741.1.61608 WP_001185741.1.61612 WP_001185741.1.61636 WP_001185741.1.61643 WP_001185741.1.61703 WP_001185741.1.61718 WP_001185741.1.61758 WP_001185741.1.61779 WP_001185741.1.61806 WP_001185741.1.61853 WP_001185741.1.61858 WP_001185741.1.61893 WP_001185741.1.61926 WP_001185741.1.61948 WP_001185741.1.61949 WP_001185741.1.61957 WP_001185741.1.61966 WP_001185741.1.6212 WP_001185741.1.62264 WP_001185741.1.62273 WP_001185741.1.62290 WP_001185741.1.62303 WP_001185741.1.62348 WP_001185741.1.62358 WP_001185741.1.62447 WP_001185741.1.6245 WP_001185741.1.62460 WP_001185741.1.62487 WP_001185741.1.62507 WP_001185741.1.62513 WP_001185741.1.62514 WP_001185741.1.62529 WP_001185741.1.62646 WP_001185741.1.62714 WP_001185741.1.62750 WP_001185741.1.62769 WP_001185741.1.62787 WP_001185741.1.62802 WP_001185741.1.62812 WP_001185741.1.62818 WP_001185741.1.62840 WP_001185741.1.62850 WP_001185741.1.62851 WP_001185741.1.6293 WP_001185741.1.62931 WP_001185741.1.62959 WP_001185741.1.62973 WP_001185741.1.62989 WP_001185741.1.6299 WP_001185741.1.62992 WP_001185741.1.63023 WP_001185741.1.63167 WP_001185741.1.63177 WP_001185741.1.63189 WP_001185741.1.63287 WP_001185741.1.6334 WP_001185741.1.63350 WP_001185741.1.63370 WP_001185741.1.63374 WP_001185741.1.63393 WP_001185741.1.63437 WP_001185741.1.63466 WP_001185741.1.63467 WP_001185741.1.63470 WP_001185741.1.63491 WP_001185741.1.63536 WP_001185741.1.63554 WP_001185741.1.63576 WP_001185741.1.63602 WP_001185741.1.63612 WP_001185741.1.63666 WP_001185741.1.63683 WP_001185741.1.63703 WP_001185741.1.63746 WP_001185741.1.63800 WP_001185741.1.63821 WP_001185741.1.63871 WP_001185741.1.63964 WP_001185741.1.63990 WP_001185741.1.64008 WP_001185741.1.64014 WP_001185741.1.64050 WP_001185741.1.64074 WP_001185741.1.64150 WP_001185741.1.64153 WP_001185741.1.64175 WP_001185741.1.64193 WP_001185741.1.64280 WP_001185741.1.64286 WP_001185741.1.64337 WP_001185741.1.64356 WP_001185741.1.64380 WP_001185741.1.64391 WP_001185741.1.6441 WP_001185741.1.64437 WP_001185741.1.64438 WP_001185741.1.64448 WP_001185741.1.64458 WP_001185741.1.64519 WP_001185741.1.64540 WP_001185741.1.64563 WP_001185741.1.64634 WP_001185741.1.64657 WP_001185741.1.6469 WP_001185741.1.64746 WP_001185741.1.64789 WP_001185741.1.64793 WP_001185741.1.64821 WP_001185741.1.64866 WP_001185741.1.64895 WP_001185741.1.64930 WP_001185741.1.64939 WP_001185741.1.64970 WP_001185741.1.651 WP_001185741.1.65110 WP_001185741.1.65135 WP_001185741.1.65155 WP_001185741.1.6516 WP_001185741.1.65179 WP_001185741.1.65192 WP_001185741.1.65206 WP_001185741.1.65271 WP_001185741.1.65296 WP_001185741.1.65305 WP_001185741.1.65353 WP_001185741.1.65364 WP_001185741.1.6537 WP_001185741.1.65370 WP_001185741.1.65408 WP_001185741.1.65415 WP_001185741.1.65484 WP_001185741.1.65493 WP_001185741.1.6553 WP_001185741.1.65531 WP_001185741.1.65581 WP_001185741.1.65667 WP_001185741.1.65672 WP_001185741.1.65677 WP_001185741.1.65708 WP_001185741.1.65714 WP_001185741.1.65912 WP_001185741.1.65954 WP_001185741.1.65962 WP_001185741.1.6599 WP_001185741.1.66001 WP_001185741.1.66007 WP_001185741.1.6604 WP_001185741.1.66059 WP_001185741.1.6609 WP_001185741.1.66102 WP_001185741.1.66104 WP_001185741.1.66121 WP_001185741.1.66181 WP_001185741.1.66187 WP_001185741.1.66197 WP_001185741.1.6622 WP_001185741.1.66251 WP_001185741.1.66264 WP_001185741.1.66288 WP_001185741.1.66335 WP_001185741.1.66412 WP_001185741.1.66432 WP_001185741.1.6645 WP_001185741.1.66550 WP_001185741.1.66559 WP_001185741.1.66579 WP_001185741.1.6665 WP_001185741.1.66719 WP_001185741.1.66758 WP_001185741.1.6676 WP_001185741.1.66791 WP_001185741.1.66795 WP_001185741.1.66849 WP_001185741.1.66926 WP_001185741.1.66933 WP_001185741.1.66975 WP_001185741.1.66978 WP_001185741.1.6701 WP_001185741.1.67018 WP_001185741.1.67026 WP_001185741.1.67102 WP_001185741.1.67149 WP_001185741.1.67193 WP_001185741.1.67194 WP_001185741.1.67209 WP_001185741.1.6723 WP_001185741.1.6735 WP_001185741.1.67412 WP_001185741.1.67415 WP_001185741.1.67452 WP_001185741.1.67454 WP_001185741.1.67462 WP_001185741.1.67467 WP_001185741.1.67468 WP_001185741.1.67538 WP_001185741.1.67549 WP_001185741.1.67553 WP_001185741.1.67663 WP_001185741.1.67704 WP_001185741.1.67724 WP_001185741.1.67786 WP_001185741.1.67788 WP_001185741.1.678 WP_001185741.1.67802 WP_001185741.1.67841 WP_001185741.1.67853 WP_001185741.1.67901 WP_001185741.1.67938 WP_001185741.1.67975 WP_001185741.1.67984 WP_001185741.1.67999 WP_001185741.1.68008 WP_001185741.1.68011 WP_001185741.1.6802 WP_001185741.1.68025 WP_001185741.1.6803 WP_001185741.1.68039 WP_001185741.1.68053 WP_001185741.1.68069 WP_001185741.1.68079 WP_001185741.1.68108 WP_001185741.1.68126 WP_001185741.1.68145 WP_001185741.1.68175 WP_001185741.1.682 WP_001185741.1.68215 WP_001185741.1.68255 WP_001185741.1.68278 WP_001185741.1.68281 WP_001185741.1.68283 WP_001185741.1.68300 WP_001185741.1.68336 WP_001185741.1.68341 WP_001185741.1.68369 WP_001185741.1.68442 WP_001185741.1.68482 WP_001185741.1.68490 WP_001185741.1.68584 WP_001185741.1.68598 WP_001185741.1.6860 WP_001185741.1.68609 WP_001185741.1.68630 WP_001185741.1.68635 WP_001185741.1.68673 WP_001185741.1.68679 WP_001185741.1.68695 WP_001185741.1.68711 WP_001185741.1.68751 WP_001185741.1.68752 WP_001185741.1.68797 WP_001185741.1.68880 WP_001185741.1.68956 WP_001185741.1.68961 WP_001185741.1.6897 WP_001185741.1.68989 WP_001185741.1.69039 WP_001185741.1.69098 WP_001185741.1.69126 WP_001185741.1.69144 WP_001185741.1.6916 WP_001185741.1.6919 WP_001185741.1.69192 WP_001185741.1.69247 WP_001185741.1.69261 WP_001185741.1.6929 WP_001185741.1.69305 WP_001185741.1.69390 WP_001185741.1.694 WP_001185741.1.69404 WP_001185741.1.69441 WP_001185741.1.69473 WP_001185741.1.69537 WP_001185741.1.69551 WP_001185741.1.69589 WP_001185741.1.69593 WP_001185741.1.69596 WP_001185741.1.69649 WP_001185741.1.69689 WP_001185741.1.69730 WP_001185741.1.69803 WP_001185741.1.69868 WP_001185741.1.69887 WP_001185741.1.69972 WP_001185741.1.69979 WP_001185741.1.70063 WP_001185741.1.70081 WP_001185741.1.70149 WP_001185741.1.70190 WP_001185741.1.70191 WP_001185741.1.70213 WP_001185741.1.70251 WP_001185741.1.70256 WP_001185741.1.70341 WP_001185741.1.70414 WP_001185741.1.70477 WP_001185741.1.70492 WP_001185741.1.70509 WP_001185741.1.7052 WP_001185741.1.70530 WP_001185741.1.70578 WP_001185741.1.70582 WP_001185741.1.70600 WP_001185741.1.70628 WP_001185741.1.70656 WP_001185741.1.70694 WP_001185741.1.70698 WP_001185741.1.70728 WP_001185741.1.70745 WP_001185741.1.70747 WP_001185741.1.70801 WP_001185741.1.70803 WP_001185741.1.70880 WP_001185741.1.7090 WP_001185741.1.70900 WP_001185741.1.70952 WP_001185741.1.70967 WP_001185741.1.71037 WP_001185741.1.71042 WP_001185741.1.71109 WP_001185741.1.71113 WP_001185741.1.71134 WP_001185741.1.71158 WP_001185741.1.71162 WP_001185741.1.71170 WP_001185741.1.71176 WP_001185741.1.71192 WP_001185741.1.71221 WP_001185741.1.71223 WP_001185741.1.71264 WP_001185741.1.71273 WP_001185741.1.71275 WP_001185741.1.71339 WP_001185741.1.71354 WP_001185741.1.71409 WP_001185741.1.7147 WP_001185741.1.71522 WP_001185741.1.71537 WP_001185741.1.71560 WP_001185741.1.71603 WP_001185741.1.71690 WP_001185741.1.71724 WP_001185741.1.71757 WP_001185741.1.71783 WP_001185741.1.71832 WP_001185741.1.71856 WP_001185741.1.71874 WP_001185741.1.7192 WP_001185741.1.71922 WP_001185741.1.71938 WP_001185741.1.71945 WP_001185741.1.71975 WP_001185741.1.71987 WP_001185741.1.71993 WP_001185741.1.72013 WP_001185741.1.72021 WP_001185741.1.7205 WP_001185741.1.72054 WP_001185741.1.72120 WP_001185741.1.72125 WP_001185741.1.72126 WP_001185741.1.72141 WP_001185741.1.72153 WP_001185741.1.72155 WP_001185741.1.72157 WP_001185741.1.72240 WP_001185741.1.72262 WP_001185741.1.72270 WP_001185741.1.72293 WP_001185741.1.72337 WP_001185741.1.72342 WP_001185741.1.72362 WP_001185741.1.72391 WP_001185741.1.72392 WP_001185741.1.72397 WP_001185741.1.72414 WP_001185741.1.72431 WP_001185741.1.72485 WP_001185741.1.72493 WP_001185741.1.72521 WP_001185741.1.72535 WP_001185741.1.72574 WP_001185741.1.72582 WP_001185741.1.72593 WP_001185741.1.72606 WP_001185741.1.72615 WP_001185741.1.72616 WP_001185741.1.72651 WP_001185741.1.72663 WP_001185741.1.72695 WP_001185741.1.72725 WP_001185741.1.72729 WP_001185741.1.72738 WP_001185741.1.72748 WP_001185741.1.72758 WP_001185741.1.72764 WP_001185741.1.7277 WP_001185741.1.72778 WP_001185741.1.72804 WP_001185741.1.72806 WP_001185741.1.72837 WP_001185741.1.72858 WP_001185741.1.72869 WP_001185741.1.72910 WP_001185741.1.72956 WP_001185741.1.72998 WP_001185741.1.73010 WP_001185741.1.73015 WP_001185741.1.73032 WP_001185741.1.73072 WP_001185741.1.73075 WP_001185741.1.73193 WP_001185741.1.73197 WP_001185741.1.73239 WP_001185741.1.73249 WP_001185741.1.73251 WP_001185741.1.73257 WP_001185741.1.73278 WP_001185741.1.73326 WP_001185741.1.73340 WP_001185741.1.73349 WP_001185741.1.73393 WP_001185741.1.73428 WP_001185741.1.73468 WP_001185741.1.7349 WP_001185741.1.73498 WP_001185741.1.73565 WP_001185741.1.73592 WP_001185741.1.73604 WP_001185741.1.73631 WP_001185741.1.73652 WP_001185741.1.73663 WP_001185741.1.73700 WP_001185741.1.73709 WP_001185741.1.73743 WP_001185741.1.73807 WP_001185741.1.73811 WP_001185741.1.73859 WP_001185741.1.73882 WP_001185741.1.73897 WP_001185741.1.73980 WP_001185741.1.73992 WP_001185741.1.73995 WP_001185741.1.73996 WP_001185741.1.74053 WP_001185741.1.7413 WP_001185741.1.74184 WP_001185741.1.74213 WP_001185741.1.74223 WP_001185741.1.7424 WP_001185741.1.74243 WP_001185741.1.7425 WP_001185741.1.74294 WP_001185741.1.74365 WP_001185741.1.74431 WP_001185741.1.74444 WP_001185741.1.74465 WP_001185741.1.74478 WP_001185741.1.74509 WP_001185741.1.74513 WP_001185741.1.74528 WP_001185741.1.7461 WP_001185741.1.74624 WP_001185741.1.74625 WP_001185741.1.74670 WP_001185741.1.74687 WP_001185741.1.74688 WP_001185741.1.74691 WP_001185741.1.74705 WP_001185741.1.7471 WP_001185741.1.74716 WP_001185741.1.7475 WP_001185741.1.74752 WP_001185741.1.7478 WP_001185741.1.7479 WP_001185741.1.74793 WP_001185741.1.74811 WP_001185741.1.74844 WP_001185741.1.74854 WP_001185741.1.74867 WP_001185741.1.74873 WP_001185741.1.74879 WP_001185741.1.74885 WP_001185741.1.74895 WP_001185741.1.74914 WP_001185741.1.74962 WP_001185741.1.74975 WP_001185741.1.74993 WP_001185741.1.74998 WP_001185741.1.75003 WP_001185741.1.75029 WP_001185741.1.75050 WP_001185741.1.75112 WP_001185741.1.75124 WP_001185741.1.75136 WP_001185741.1.75138 WP_001185741.1.75143 WP_001185741.1.75155 WP_001185741.1.75209 WP_001185741.1.75219 WP_001185741.1.75221 WP_001185741.1.75247 WP_001185741.1.75254 WP_001185741.1.75270 WP_001185741.1.75435 WP_001185741.1.75465 WP_001185741.1.75505 WP_001185741.1.75568 WP_001185741.1.75588 WP_001185741.1.75594 WP_001185741.1.75602 WP_001185741.1.75629 WP_001185741.1.75653 WP_001185741.1.75676 WP_001185741.1.75696 WP_001185741.1.75698 WP_001185741.1.75758 WP_001185741.1.75803 WP_001185741.1.75973 WP_001185741.1.75983 WP_001185741.1.75999 WP_001185741.1.76009 WP_001185741.1.7603 WP_001185741.1.76036 WP_001185741.1.76087 WP_001185741.1.76089 WP_001185741.1.76103 WP_001185741.1.76118 WP_001185741.1.76129 WP_001185741.1.76312 WP_001185741.1.7637 WP_001185741.1.76384 WP_001185741.1.76447 WP_001185741.1.76452 WP_001185741.1.76460 WP_001185741.1.76466 WP_001185741.1.76542 WP_001185741.1.76544 WP_001185741.1.76595 WP_001185741.1.76612 WP_001185741.1.76619 WP_001185741.1.76701 WP_001185741.1.76705 WP_001185741.1.76815 WP_001185741.1.76884 WP_001185741.1.76918 WP_001185741.1.76957 WP_001185741.1.76966 WP_001185741.1.7699 WP_001185741.1.77015 WP_001185741.1.77070 WP_001185741.1.77120 WP_001185741.1.77147 WP_001185741.1.77198 WP_001185741.1.77255 WP_001185741.1.77258 WP_001185741.1.7728 WP_001185741.1.77284 WP_001185741.1.77288 WP_001185741.1.77341 WP_001185741.1.77358 WP_001185741.1.77391 WP_001185741.1.77437 WP_001185741.1.77452 WP_001185741.1.77477 WP_001185741.1.77495 WP_001185741.1.775 WP_001185741.1.77503 WP_001185741.1.77542 WP_001185741.1.77551 WP_001185741.1.77581 WP_001185741.1.77600 WP_001185741.1.77608 WP_001185741.1.77636 WP_001185741.1.77725 WP_001185741.1.77741 WP_001185741.1.77767 WP_001185741.1.77813 WP_001185741.1.77826 WP_001185741.1.77833 WP_001185741.1.77876 WP_001185741.1.77929 WP_001185741.1.77949 WP_001185741.1.7795 WP_001185741.1.77999 WP_001185741.1.78041 WP_001185741.1.78059 WP_001185741.1.7806 WP_001185741.1.78089 WP_001185741.1.78097 WP_001185741.1.78099 WP_001185741.1.78102 WP_001185741.1.78196 WP_001185741.1.78337 WP_001185741.1.78340 WP_001185741.1.78377 WP_001185741.1.7851 WP_001185741.1.78515 WP_001185741.1.78553 WP_001185741.1.78583 WP_001185741.1.78586 WP_001185741.1.78610 WP_001185741.1.78615 WP_001185741.1.78645 WP_001185741.1.78683 WP_001185741.1.78696 WP_001185741.1.78698 WP_001185741.1.78746 WP_001185741.1.78757 WP_001185741.1.78775 WP_001185741.1.78843 WP_001185741.1.78888 WP_001185741.1.78891 WP_001185741.1.78953 WP_001185741.1.7896 WP_001185741.1.78966 WP_001185741.1.7898 WP_001185741.1.79002 WP_001185741.1.79004 WP_001185741.1.7901 WP_001185741.1.79075 WP_001185741.1.79088 WP_001185741.1.79090 WP_001185741.1.79092 WP_001185741.1.79226 WP_001185741.1.79308 WP_001185741.1.79312 WP_001185741.1.7937 WP_001185741.1.79391 WP_001185741.1.79416 WP_001185741.1.79478 WP_001185741.1.79519 WP_001185741.1.79526 WP_001185741.1.79606 WP_001185741.1.79685 WP_001185741.1.79713 WP_001185741.1.79800 WP_001185741.1.79816 WP_001185741.1.79824 WP_001185741.1.79840 WP_001185741.1.79869 WP_001185741.1.7987 WP_001185741.1.79905 WP_001185741.1.7993 WP_001185741.1.79932 WP_001185741.1.79936 WP_001185741.1.79944 WP_001185741.1.80011 WP_001185741.1.80043 WP_001185741.1.80061 WP_001185741.1.8007 WP_001185741.1.80071 WP_001185741.1.80136 WP_001185741.1.80141 WP_001185741.1.80176 WP_001185741.1.80192 WP_001185741.1.80255 WP_001185741.1.80292 WP_001185741.1.80310 WP_001185741.1.80388 WP_001185741.1.80440 WP_001185741.1.80444 WP_001185741.1.80456 WP_001185741.1.80463 WP_001185741.1.80484 WP_001185741.1.80517 WP_001185741.1.80545 WP_001185741.1.80594 WP_001185741.1.80612 WP_001185741.1.80676 WP_001185741.1.80709 WP_001185741.1.80731 WP_001185741.1.80736 WP_001185741.1.80737 WP_001185741.1.8074 WP_001185741.1.80754 WP_001185741.1.80789 WP_001185741.1.808 WP_001185741.1.80805 WP_001185741.1.80843 WP_001185741.1.80882 WP_001185741.1.80884 WP_001185741.1.80894 WP_001185741.1.8090 WP_001185741.1.8091 WP_001185741.1.80945 WP_001185741.1.80946 WP_001185741.1.80954 WP_001185741.1.80966 WP_001185741.1.80983 WP_001185741.1.80985 WP_001185741.1.810 WP_001185741.1.81034 WP_001185741.1.81054 WP_001185741.1.81071 WP_001185741.1.811 WP_001185741.1.81104 WP_001185741.1.81180 WP_001185741.1.8121 WP_001185741.1.81281 WP_001185741.1.8129 WP_001185741.1.81298 WP_001185741.1.81316 WP_001185741.1.81376 WP_001185741.1.81391 WP_001185741.1.81469 WP_001185741.1.81484 WP_001185741.1.81517 WP_001185741.1.8156 WP_001185741.1.81582 WP_001185741.1.81596 WP_001185741.1.81602 WP_001185741.1.81625 WP_001185741.1.81688 WP_001185741.1.81692 WP_001185741.1.81715 WP_001185741.1.81819 WP_001185741.1.81832 WP_001185741.1.81869 WP_001185741.1.81876 WP_001185741.1.81881 WP_001185741.1.81939 WP_001185741.1.81952 WP_001185741.1.81956 WP_001185741.1.81972 WP_001185741.1.82 WP_001185741.1.82032 WP_001185741.1.82059 WP_001185741.1.82061 WP_001185741.1.82062 WP_001185741.1.82074 WP_001185741.1.82095 WP_001185741.1.82116 WP_001185741.1.82137 WP_001185741.1.82240 WP_001185741.1.82242 WP_001185741.1.82246 WP_001185741.1.82275 WP_001185741.1.82280 WP_001185741.1.82316 WP_001185741.1.82320 WP_001185741.1.82326 WP_001185741.1.82330 WP_001185741.1.82378 WP_001185741.1.82438 WP_001185741.1.82439 WP_001185741.1.82485 WP_001185741.1.82499 WP_001185741.1.82507 WP_001185741.1.82572 WP_001185741.1.82614 WP_001185741.1.82626 WP_001185741.1.82647 WP_001185741.1.82705 WP_001185741.1.82715 WP_001185741.1.8277 WP_001185741.1.82780 WP_001185741.1.82831 WP_001185741.1.82902 WP_001185741.1.83020 WP_001185741.1.83033 WP_001185741.1.83051 WP_001185741.1.8306 WP_001185741.1.831 WP_001185741.1.83160 WP_001185741.1.83177 WP_001185741.1.83286 WP_001185741.1.83321 WP_001185741.1.83330 WP_001185741.1.83340 WP_001185741.1.83347 WP_001185741.1.83466 WP_001185741.1.83481 WP_001185741.1.83564 WP_001185741.1.83584 WP_001185741.1.83762 WP_001185741.1.83947 WP_001185741.1.84060 WP_001185741.1.84074 WP_001185741.1.84140 WP_001185741.1.84164 WP_001185741.1.84172 WP_001185741.1.84185 WP_001185741.1.84210 WP_001185741.1.84339 WP_001185741.1.84405 WP_001185741.1.84410 WP_001185741.1.84436 WP_001185741.1.84462 WP_001185741.1.84473 WP_001185741.1.84484 WP_001185741.1.84518 WP_001185741.1.84656 WP_001185741.1.84675 WP_001185741.1.84697 WP_001185741.1.84768 WP_001185741.1.84784 WP_001185741.1.84841 WP_001185741.1.84850 WP_001185741.1.84878 WP_001185741.1.84881 WP_001185741.1.84916 WP_001185741.1.84929 WP_001185741.1.84941 WP_001185741.1.84986 WP_001185741.1.84990 WP_001185741.1.84994 WP_001185741.1.85008 WP_001185741.1.85011 WP_001185741.1.85105 WP_001185741.1.85129 WP_001185741.1.85141 WP_001185741.1.85156 WP_001185741.1.85175 WP_001185741.1.85216 WP_001185741.1.85247 WP_001185741.1.85260 WP_001185741.1.85305 WP_001185741.1.85335 WP_001185741.1.85369 WP_001185741.1.85385 WP_001185741.1.85416 WP_001185741.1.85525 WP_001185741.1.85546 WP_001185741.1.85563 WP_001185741.1.8560 WP_001185741.1.85601 WP_001185741.1.85685 WP_001185741.1.85762 WP_001185741.1.85767 WP_001185741.1.8579 WP_001185741.1.85793 WP_001185741.1.85800 WP_001185741.1.85857 WP_001185741.1.85895 WP_001185741.1.85939 WP_001185741.1.85944 WP_001185741.1.85969 WP_001185741.1.86 WP_001185741.1.86035 WP_001185741.1.86063 WP_001185741.1.8607 WP_001185741.1.86115 WP_001185741.1.86145 WP_001185741.1.86149 WP_001185741.1.86181 WP_001185741.1.86263 WP_001185741.1.86280 WP_001185741.1.8635 WP_001185741.1.86355 WP_001185741.1.86364 WP_001185741.1.86376 WP_001185741.1.86393 WP_001185741.1.86451 WP_001185741.1.86452 WP_001185741.1.86461 WP_001185741.1.86475 WP_001185741.1.86483 WP_001185741.1.86492 WP_001185741.1.86518 WP_001185741.1.8652 WP_001185741.1.86583 WP_001185741.1.86598 WP_001185741.1.86609 WP_001185741.1.86640 WP_001185741.1.86667 WP_001185741.1.86674 WP_001185741.1.86707 WP_001185741.1.86833 WP_001185741.1.86846 WP_001185741.1.86848 WP_001185741.1.8687 WP_001185741.1.86935 WP_001185741.1.86956 WP_001185741.1.86975 WP_001185741.1.86997 WP_001185741.1.87059 WP_001185741.1.87075 WP_001185741.1.8711 WP_001185741.1.87177 WP_001185741.1.87249 WP_001185741.1.87310 WP_001185741.1.87339 WP_001185741.1.87358 WP_001185741.1.87389 WP_001185741.1.87400 WP_001185741.1.87465 WP_001185741.1.87557 WP_001185741.1.87563 WP_001185741.1.87607 WP_001185741.1.87608 WP_001185741.1.87639 WP_001185741.1.87694 WP_001185741.1.8771 WP_001185741.1.87721 WP_001185741.1.87726 WP_001185741.1.87728 WP_001185741.1.87786 WP_001185741.1.87788 WP_001185741.1.87822 WP_001185741.1.87834 WP_001185741.1.87919 WP_001185741.1.87973 WP_001185741.1.87976 WP_001185741.1.87984 WP_001185741.1.87989 WP_001185741.1.880 WP_001185741.1.88017 WP_001185741.1.88020 WP_001185741.1.88066 WP_001185741.1.88088 WP_001185741.1.88110 WP_001185741.1.88155 WP_001185741.1.88189 WP_001185741.1.88252 WP_001185741.1.88285 WP_001185741.1.88301 WP_001185741.1.88304 WP_001185741.1.88352 WP_001185741.1.88376 WP_001185741.1.88379 WP_001185741.1.88384 WP_001185741.1.88413 WP_001185741.1.88427 WP_001185741.1.88434 WP_001185741.1.88438 WP_001185741.1.88462 WP_001185741.1.88535 WP_001185741.1.88539 WP_001185741.1.8854 WP_001185741.1.88577 WP_001185741.1.88603 WP_001185741.1.88631 WP_001185741.1.88646 WP_001185741.1.88678 WP_001185741.1.88685 WP_001185741.1.88710 WP_001185741.1.88720 WP_001185741.1.88732 WP_001185741.1.88735 WP_001185741.1.88759 WP_001185741.1.8879 WP_001185741.1.88834 WP_001185741.1.88864 WP_001185741.1.88883 WP_001185741.1.88997 WP_001185741.1.89018 WP_001185741.1.89050 WP_001185741.1.8906 WP_001185741.1.89067 WP_001185741.1.89090 WP_001185741.1.89097 WP_001185741.1.89099 WP_001185741.1.89111 WP_001185741.1.89183 WP_001185741.1.89197 WP_001185741.1.89200 WP_001185741.1.89305 WP_001185741.1.8938 WP_001185741.1.894 WP_001185741.1.89400 WP_001185741.1.89403 WP_001185741.1.89432 WP_001185741.1.8945 WP_001185741.1.89458 WP_001185741.1.89471 WP_001185741.1.89474 WP_001185741.1.89479 WP_001185741.1.89510 WP_001185741.1.89601 WP_001185741.1.89605 WP_001185741.1.89646 WP_001185741.1.89656 WP_001185741.1.89674 WP_001185741.1.89679 WP_001185741.1.89768 WP_001185741.1.89788 WP_001185741.1.89818 WP_001185741.1.89839 WP_001185741.1.89841 WP_001185741.1.89859 WP_001185741.1.89895 WP_001185741.1.89915 WP_001185741.1.89918 WP_001185741.1.89920 WP_001185741.1.89925 WP_001185741.1.89998 WP_001185741.1.90063 WP_001185741.1.90065 WP_001185741.1.9009 WP_001185741.1.9010 WP_001185741.1.90115 WP_001185741.1.90128 WP_001185741.1.90156 WP_001185741.1.90168 WP_001185741.1.90182 WP_001185741.1.90205 WP_001185741.1.90249 WP_001185741.1.90256 WP_001185741.1.90270 WP_001185741.1.90314 WP_001185741.1.90332 WP_001185741.1.9036 WP_001185741.1.90405 WP_001185741.1.90435 WP_001185741.1.90436 WP_001185741.1.90441 WP_001185741.1.90467 WP_001185741.1.90536 WP_001185741.1.90547 WP_001185741.1.9059 WP_001185741.1.90591 WP_001185741.1.90626 WP_001185741.1.90758 WP_001185741.1.9081 WP_001185741.1.90813 WP_001185741.1.90828 WP_001185741.1.9084 WP_001185741.1.90864 WP_001185741.1.90873 WP_001185741.1.90979 WP_001185741.1.91018 WP_001185741.1.91094 WP_001185741.1.91113 WP_001185741.1.91117 WP_001185741.1.91138 WP_001185741.1.91170 WP_001185741.1.9118 WP_001185741.1.91266 WP_001185741.1.91277 WP_001185741.1.91340 WP_001185741.1.91341 WP_001185741.1.91397 WP_001185741.1.91485 WP_001185741.1.915 WP_001185741.1.91526 WP_001185741.1.91565 WP_001185741.1.91594 WP_001185741.1.91596 WP_001185741.1.9160 WP_001185741.1.91630 WP_001185741.1.91643 WP_001185741.1.91644 WP_001185741.1.91672 WP_001185741.1.91685 WP_001185741.1.91701 WP_001185741.1.9171 WP_001185741.1.91777 WP_001185741.1.91779 WP_001185741.1.91787 WP_001185741.1.91793 WP_001185741.1.91951 WP_001185741.1.91959 WP_001185741.1.91971 WP_001185741.1.92014 WP_001185741.1.92029 WP_001185741.1.92048 WP_001185741.1.92058 WP_001185741.1.921 WP_001185741.1.92123 WP_001185741.1.92163 WP_001185741.1.92180 WP_001185741.1.92195 WP_001185741.1.92215 WP_001185741.1.92311 WP_001185741.1.924 WP_001185741.1.92434 WP_001185741.1.92462 WP_001185741.1.92495 WP_001185741.1.92506 WP_001185741.1.92535 WP_001185741.1.9255 WP_001185741.1.92568 WP_001185741.1.92571 WP_001185741.1.92577 WP_001185741.1.92614 WP_001185741.1.9266 WP_001185741.1.92668 WP_001185741.1.92719 WP_001185741.1.92780 WP_001185741.1.92792 WP_001185741.1.92793 WP_001185741.1.92796 WP_001185741.1.92865 WP_001185741.1.92932 WP_001185741.1.92943 WP_001185741.1.92953 WP_001185741.1.92991 WP_001185741.1.93005 WP_001185741.1.93016 WP_001185741.1.93019 WP_001185741.1.93048 WP_001185741.1.93072 WP_001185741.1.93085 WP_001185741.1.93100 WP_001185741.1.93133 WP_001185741.1.93175 WP_001185741.1.93252 WP_001185741.1.93267 WP_001185741.1.93338 WP_001185741.1.93379 WP_001185741.1.93388 WP_001185741.1.93468 WP_001185741.1.93509 WP_001185741.1.93531 WP_001185741.1.93569 WP_001185741.1.93605 WP_001185741.1.93634 WP_001185741.1.93637 WP_001185741.1.93665 WP_001185741.1.93673 WP_001185741.1.93742 WP_001185741.1.93743 WP_001185741.1.93755 WP_001185741.1.938 WP_001185741.1.93800 WP_001185741.1.93877 WP_001185741.1.939 WP_001185741.1.93900 WP_001185741.1.93911 WP_001185741.1.93918 WP_001185741.1.93921 WP_001185741.1.94008 WP_001185741.1.94011 WP_001185741.1.94057 WP_001185741.1.94156 WP_001185741.1.94187 WP_001185741.1.94190 WP_001185741.1.94232 WP_001185741.1.94317 WP_001185741.1.94404 WP_001185741.1.94429 WP_001185741.1.94468 WP_001185741.1.94475 WP_001185741.1.94497 WP_001185741.1.94507 WP_001185741.1.94516 WP_001185741.1.94523 WP_001185741.1.94548 WP_001185741.1.9457 WP_001185741.1.94578 WP_001185741.1.94690 WP_001185741.1.94753 WP_001185741.1.94787 WP_001185741.1.948 WP_001185741.1.94801 WP_001185741.1.94822 WP_001185741.1.94877 WP_001185741.1.94880 WP_001185741.1.94889 WP_001185741.1.949 WP_001185741.1.94903 WP_001185741.1.94949 WP_001185741.1.94963 WP_001185741.1.94993 WP_001185741.1.95022 WP_001185741.1.95036 WP_001185741.1.95062 WP_001185741.1.9513 WP_001185741.1.95161 WP_001185741.1.95198 WP_001185741.1.95233 WP_001185741.1.95243 WP_001185741.1.95254 WP_001185741.1.95332 WP_001185741.1.95381 WP_001185741.1.95390 WP_001185741.1.95400 WP_001185741.1.95403 WP_001185741.1.95424 WP_001185741.1.95431 WP_001185741.1.95438 WP_001185741.1.95521 WP_001185741.1.95563 WP_001185741.1.9559 WP_001185741.1.95595 WP_001185741.1.95596 WP_001185741.1.95604 WP_001185741.1.95611 WP_001185741.1.95712 WP_001185741.1.95756 WP_001185741.1.95759 WP_001185741.1.95771 WP_001185741.1.95800 WP_001185741.1.95821 WP_001185741.1.95824 WP_001185741.1.95835 WP_001185741.1.95865 WP_001185741.1.95869 WP_001185741.1.95916 WP_001185741.1.960 WP_001185741.1.96032 WP_001185741.1.96053 WP_001185741.1.96066 WP_001185741.1.96114 WP_001185741.1.96128 WP_001185741.1.96177 WP_001185741.1.96222 WP_001185741.1.96247 WP_001185741.1.96290 WP_001185741.1.96293 WP_001185741.1.96420 WP_001185741.1.96479 WP_001185741.1.96484 WP_001185741.1.96494 WP_001185741.1.965 WP_001185741.1.96562 WP_001185741.1.9657 WP_001185741.1.96608 WP_001185741.1.96680 WP_001185741.1.96683 WP_001185741.1.96701 WP_001185741.1.96743 WP_001185741.1.96753 WP_001185741.1.96769 WP_001185741.1.96779 WP_001185741.1.96817 WP_001185741.1.9690 WP_001185741.1.9691 WP_001185741.1.96924 WP_001185741.1.96932 WP_001185741.1.96989 WP_001185741.1.97011 WP_001185741.1.97027 WP_001185741.1.97049 WP_001185741.1.9708 WP_001185741.1.97123 WP_001185741.1.97195 WP_001185741.1.97200 WP_001185741.1.97231 WP_001185741.1.97238 WP_001185741.1.97248 WP_001185741.1.97279 WP_001185741.1.97344 WP_001185741.1.97356 WP_001185741.1.97360 WP_001185741.1.97361 WP_001185741.1.97421 WP_001185741.1.97434 WP_001185741.1.9747 WP_001185741.1.97490 WP_001185741.1.97527 WP_001185741.1.97544 WP_001185741.1.97667 WP_001185741.1.97675 WP_001185741.1.97685 WP_001185741.1.97705 WP_001185741.1.97711 WP_001185741.1.97775 WP_001185741.1.97798 WP_001185741.1.97802 WP_001185741.1.97815 WP_001185741.1.97822 WP_001185741.1.97895 WP_001185741.1.97930 WP_001185741.1.97937 WP_001185741.1.97962 WP_001185741.1.9803 WP_001185741.1.98082 WP_001185741.1.98115 WP_001185741.1.98139 WP_001185741.1.9816 WP_001185741.1.98208 WP_001185741.1.98239 WP_001185741.1.98241 WP_001185741.1.98284 WP_001185741.1.98323 WP_001185741.1.98355 WP_001185741.1.98357 WP_001185741.1.98424 WP_001185741.1.9844 WP_001185741.1.98451 WP_001185741.1.98477 WP_001185741.1.98498 WP_001185741.1.98549 WP_001185741.1.98587 WP_001185741.1.98603 WP_001185741.1.98641 WP_001185741.1.98654 WP_001185741.1.98665 WP_001185741.1.98668 WP_001185741.1.98702 WP_001185741.1.98875 WP_001185741.1.98886 WP_001185741.1.98908 WP_001185741.1.98976 WP_001185741.1.98988 WP_001185741.1.99053 WP_001185741.1.9907 WP_001185741.1.99110 WP_001185741.1.99119 WP_001185741.1.99168 WP_001185741.1.99209 WP_001185741.1.99246 WP_001185741.1.99292 WP_001185741.1.99295 WP_001185741.1.99302 WP_001185741.1.99334 WP_001185741.1.99345 WP_001185741.1.99361 WP_001185741.1.99392 WP_001185741.1.99427 WP_001185741.1.99446 WP_001185741.1.99453 WP_001185741.1.99471 WP_001185741.1.99486 WP_001185741.1.99511 WP_001185741.1.99534 WP_001185741.1.99562 WP_001185741.1.99603 WP_001185741.1.99619 WP_001185741.1.99641 WP_001185741.1.99666 WP_001185741.1.99774 WP_001185741.1.99791 WP_001185741.1.99804 WP_001185741.1.99827 WP_001185741.1.99869 WP_001185741.1.99912 YP_025309.2.90541 gi|378712682|ref|YP_005277575.1| 300269.SSON_1244 316385.ECDH10B_2015 316407.cutC 331111.EcE24377A_2106 373384.SFV_1912 409438.ECSE_2109 511145.b1874 573235.ECO26_2726 585034.ECIAI1_1961 585395.ECO103_2136 585396.ECO111_2460 595496.BWG_1688 gi|532141254|ref|NP_707762.3| gi|74311776|ref|YP_310195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]