SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|167384|e_gw1.30.222.1 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Apimo1|167384|e_gw1.30.222.1
Domain Number 1 Region: 52-366
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.59e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000567
Further Details:      
 
Domain Number 2 Region: 549-751
Classification Level Classification E-value
Superfamily ITPase-like 2.68e-43
Family Maf-like 0.0000759
Further Details:      
 
Domain Number 3 Region: 367-496
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.46e-16
Family Anticodon-binding domain of Class II aaRS 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|167384|e_gw1.30.222.1
Sequence length 779
Sequence
MFVRRITRLRPQGLPSVPPQIRAIRPTTHVLRRACASCATSTAGLPPKPAADHRQLGVQQ
ELFTTSIYSPGSPILLPNGARIFNRLVEFLRKQYVRYGFQEVITPTIYKKSLWVKSGHLE
NYSDDMFTVTSTSPSRKDESEAGEEDEYGLKPMNCPGHCLIFAAQHHSYRDLPIRYADFS
PLHRNEISGALSGLTRVRRFHQDDGHIFCRPSQIEEEIKKTLDFVRVAYKVFKLGPYRLA
LSTRPADHFIGTAEDWDRAETGLKRALDASGQEWTVNEGDGAFYGPKIDIILRDSDGKEH
QTATIQLDFQLPKRFELEYQAPAPELEQRGETTTDAEKLAESGPVTPVLIHRAVLGSVER
LMALLIEHYDGKWPFWLNPRQVMILAVNDSQPVLEWAETARNILTGTHEQIAGEDGPVTN
ATQLTVDIDDRKTSIGAKVREAKAKGYGVIVTVGPRQLPNGTVTVDMTNLNVGDENGVHK
QKEMSPQELLGLLKAKVDSNPDGAPADSPPDYDTAARDHGLPVRQPPAGAPAARKPPPPF
ELPILTYMKSHKVILASGSPRRKMLLHRLGLTDFEVVPSTLPEDLCKTTLVPFEYVTATA
RQKCLDVYEKAVEKGGEPDLVISADTVIVTREGRILEKPSSEAAHIRMLQHLRDTRVHRV
LSAVCCLAPKEEATFPGYEIETHVEETKVFFAKEADGLGDDVIRSYVRTREGVDKAGGYA
IQGLAGMVLVEKVEGSVDNVVGLPVRKMLQLCGRVVFEQGQNSEEWQKNEDDDDDDYDE
Download sequence
Identical sequences jgi|Apimo1|167384|e_gw1.30.222.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]