SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|160884|e_gw1.5.273.1 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Apimo1|160884|e_gw1.5.273.1
Domain Number 1 Region: 118-214
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000317
Family Limonene-1,2-epoxide hydrolase-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|160884|e_gw1.5.273.1
Sequence length 273
Sequence
MAELPDYMTDPNAVLKDTNAEWRHGQPPDYSKTRRVFEQTKQTSHEPGSLPDLVQNLVKN
WEIEASFKTNLRDWRTVDPEVYTFAVNGGPPQPAEHMLKVGTYNAIIGAPNAWYSPRRSD
LASSHKTFKRMMPTFAWEVLEVYGGPPVVAFKWRHWGEMKEDYVSLDDNGEKITAKAHGG
TIDIQGVTVAHLNDKFQVTKLETWFDPVEMFRQIAPEGSALSKQSSAALAGAAAGCPVMA
GGHGVLSGEAVQGTGNGSAEATVVLEAESGQHP
Download sequence
Identical sequences jgi|Apimo1|160884|e_gw1.5.273.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]