SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|224837|estExt_Genewise1Plus.C_580050 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Apimo1|224837|estExt_Genewise1Plus.C_580050
Domain Number 1 Region: 242-384
Classification Level Classification E-value
Superfamily NTF2-like 5.54e-21
Family SnoaL-like polyketide cyclase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|224837|estExt_Genewise1Plus.C_580050
Sequence length 436
Sequence
MSSSNPEKTPAAVVPRPNAPSIVVSPTLTLQPPLSRRGHGPGLVLLVDPVLDLTSCHDKT
LDPPPLQKWAEEGYAVAQLRLVPNEVVEDTTAAAEVIQEAIQELAKLPSCDPTEKLGFIV
YSAATKACPITTTVIEAACKKAAAVVYYGAEPASSSYTAGSSQIPVLAHLPGSGLSKPSD
GSEAAAAAATPDHVKQHYYGPAAKGAAFAIPAHADFQASSASVAHTRTLSFLKPLVGGPW
FDLEKIWDEHTYWEFEARDVEQTMATMVEEPYVNHIPTLTGGVGRKKLTEFYTNHFVFAN
PPDTELELISRTVGIDRVIDEFVTKMTHDRVVDWLVPGVPPTGIYLQIPFTSIVNIRGDR
LYHEHISWDQGTLLRQLGLLPEYLPFPYPVASAQPDEKMEYRLPVAGVESAQKLRDESAV
ESNFMLEYSTRKATEQ
Download sequence
Identical sequences jgi|Apimo1|224837|estExt_Genewise1Plus.C_580050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]