SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Apimo1|46678|fgenesh1_kg.3_#_164_#_Locus7832v1rpkm5.34 from Apiospora montagnei NRRL 25634 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Apimo1|46678|fgenesh1_kg.3_#_164_#_Locus7832v1rpkm5.34
Domain Number 1 Region: 266-395
Classification Level Classification E-value
Superfamily NTF2-like 4.62e-20
Family SnoaL-like polyketide cyclase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Apimo1|46678|fgenesh1_kg.3_#_164_#_Locus7832v1rpkm5.34
Sequence length 529
Sequence
MFDVPKIVEAALPEKERNGRTLGIVGGSMAGPGPNHNDPGFLSDDFPKSKPKLYITGEEE
YFDELTIAEWKNEGFEVEYISMGNGGKEYQSHLRALTNQDLGPCETFGIVAYGKAASECL
SFFHVLDNNPSFKLCCLIAYYPTSVPDPRTRFPGGVHVLVHLAEGDETIGIVKQDQMVGI
QGKKRTVKRQMPHGMGTGKYVKYSYPTYSYDADSGFAEQDMDEFDAISTDLAWTRSLATA
RRAFRRDVNLERVHEENVNAKYYTQNLQKTMSTYTANTTPNVTNMPTLTGGIGADELHDF
YGHYFLHKNPKSLRLTLLSRTIGVNRVVDELHVAFRHTQEMPWILPGVPPTKKKVEVLVV
SIVTVRGGKLAHERVFWDQASVLFQVGLLDPNLIPAPAKRRGVTKLPVIGREAAQRRLEG
NEDGEDGEADNELIPDWYNEDDEDDDEEEEEEEDEDEEEGEGEDDAKQNGAQGQQEEEAE
QEDGSEEEGEQDGEESEDGDEEDGHHDDDDTMVEPDKAHHSDEEPSRRS
Download sequence
Identical sequences jgi|Apimo1|46678|fgenesh1_kg.3_#_164_#_Locus7832v1rpkm5.34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]