SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000056 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000056
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 1.06e-127
Family ALDH-like 0.0000000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000056   Gene: ENSMPUG00000000056   Transcript: ENSMPUT00000000056
Sequence length 485
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897131.1:2286549:2305754:1 gene:ENSMPUG00000000056 transcript:ENSMPUT00000000056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRIQRVRDAFASGRSRPLRFRLQQLEALRRMVQEREKDILQAIGADLCKSEFNAYSQE
VITILGELDLVLENLSEWVTATPAKKNLLTMLDEAYVQPEPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSEKTAQLLAKLLPQYLDQELYAVINGGIPETTELLKQRFDH
ILYTGNTAVGRIVMEAAAKHLTPVTLELGGKSPCYIDTDCDLDVACRRITWGKYMNCGQT
CIAPDYVLCEPSLQHQIVQKIKETVKEFYGENIKESPDYERIINLRHFKRILNLLEGQKI
AFGGETDEATRYVAPTILTDVDPEARVMQEEIFGPILPIVPVKDADEAIKFINSREKPLA
FYIFSHNDKLVRRMINSTSSGGVTANDVIMHFTLSSLPFGGVGSSGMGAYHGKYSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWAKFFILKRFNRGKLGLLLLALLGIVAAVLL
KARYY
Download sequence
Identical sequences M3XLV6
ENSMPUP00000000056 ENSMPUP00000000056 XP_004776630.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]