SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000058 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000058
Domain Number 1 Region: 242-430
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-43
Family ALDH-like 0.000000107
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily ALDH-like 0.00000157
Family ALDH-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000058   Gene: ENSMPUG00000000058   Transcript: ENSMPUT00000000058
Sequence length 450
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897131.1:2344848:2350176:-1 gene:ENSMPUG00000000058 transcript:ENSMPUT00000000058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISEVVQRARAAFNLGKTRPLQFRIQQLEALRCMIKEHEKDIVGALTADLHKDTVNFR
SAYSLSPQPNVGPPSPPPSPREHPSLASQRAPPSLSIHPSPEFLVLKQKLHNFCFALSQP
KVASSPPTPGGSLEPSSPSPSAAEGLLDFVLSLAVFFLDLFLQGGLLRAPSWVQGSFQPK
SIPGAPPLGSPHLHIPAQIKGPSWVHHPGGKSSAWLGPPCLLWPQHPTWGAPRSQIQGTV
CQDHTISTPSISSQEIEYMIKKLPEWAADEPVKSRDYGRIINSRHFQRVMGLMEGQKVAY
GGTGDAATRYIASAPTILIDVDPKSPVMQEEIFGPVMPIMCVRSLEEAIQFINQREKPLA
LYVFSLNDKVVKKVIAETSSGGVTANDVIVHISVHSLPYGGVGNSGMGSYHGKKSFETFS
HRRSCLVRPLLNDESLKARYPPSMAKMTRH
Download sequence
Identical sequences M3XLV8
ENSMPUP00000000058 ENSMPUP00000000058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]