SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000155 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000155
Domain Number 1 Region: 1040-1307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-68
Family Protein kinases, catalytic subunit 0.0000372
Further Details:      
 
Domain Number 2 Region: 113-212
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000391
Family N-terminal PAS domain of Pas kinase 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000155
Domain Number - Region: 223-294
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000913
Family Heme-binding PAS domain 0.016
Further Details:      
 
Domain Number - Region: 329-369
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00454
Family Heme-binding PAS domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000155   Gene: ENSMPUG00000000158   Transcript: ENSMPUT00000000159
Sequence length 1341
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:3251466:3279628:-1 gene:ENSMPUG00000000158 transcript:ENSMPUT00000000159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRGSPESPAAQTATEPSESLSSAHRHLSRRNGLSKLCQSRMGLSEDKWNSYCLSSLAA
QSICTSRLHCLVPPEQTDLAGSLGSASCCSLLRGLSSGWSTPLFPTPVCNPNKAVFTVDA
KTTEILVANDKACQLLGHSSHDLIGQKLTQFFLRPDSDVVKALSEEHMGADGRAAVVFGT
VVDVVSRSGERIPVSVWMKKVKQEHSLCCVVVLEPVERVSAWVAFQSDGTITSCDSPFAL
LHGYASGEDVLGQPITDLIPSVQLPTPGEPVPQNLKIQRSVGRAKDGTTFPLSLKLKSQS
SSETAEDGRMVPEWSYSASIWVFSTISGLITLLPDGTIYGINHSFALMLFGYGKTELLGK
NITFLIPGFYHGMGLACDTSFPLPDLADQSGPGETSVGPRQSRNWAGTGVEPLDPRAPSA
SVGGHVLPGGETLEPVGRSQEDFTGTWTQADPGGHLPSSLPCLPTPGVESILEGGPPAQE
WSSPEDQRDIPEGSPPAQEWSSPKDQRDIPEGSLPAQERSSPEDQRDIPEGIPPGQEWSS
SEDQRAIPEGSPSALTQQSSPKDQPNPLLEKEDSAAPESLRQDLVERSGSDPVDTWMSAS
REASEGRSGQAKMSRPYREAQPEWTNSSSAHHSNCWVDSLMSKPYAAGKLAGEGLLLPCP
GYGGEQSTQSGSPPGTAQLPFSTPALDELWVAVENDREELQTCLIKEQLSKLSLVGPLGV
SYTELAPADHPRCSASVSLCDLGSRGLSSRGGSSSACYALATDLPGVLDTVQAQEADGNS
FSWNLKELFLDEWTDRTSSNCSCTTMEIVGTPSPLPVGSDADLSGLHRRGSDVLDDRELL
LLTGTYFHLGEARQFHESHLVPDPVEPSEMCLVSSEHYAVSGRESHTCILPTLGAGPVDV
CPAEEPRLSFQVTSTPVRTDSPATSGATCVRQEIQEGTYAGSCHHRDGAQLSVQFEVKRV
ELQGSSTLFCCWLVKDLLHSHWDSATRTRLLLASLPSSSHSMCELSGPSVGEMLRSKPWF
EEPPKAMELEGLAACEGAYSHKYSTLSPLGSGAFGFVWTAVDKEANKEVVVKFIKKEKVL
EDCWIEDPKLGKVTLEIAILSRVDHANIIKVLDVFENQGFFQLVMEKHGSGLDLFAFIDL
HPNLDEPLASYIFRQLVAAVGYLRSKNIIHRDIKDENIVIAEDFTIKLIDFGSAAYLEKG
RLFHTFCGTIEYCAPEVLMGNPYKGPELEMWSLGVTLYTLIFEENPFCELEETMEATIHP
PYLVSEDLMNLMSGLLQPVPEQRTTLEKLVTDPWVTQPVNLANYTWDEVCHMNKPESGAL
SGVSLETESRCAREVAWALEP
Download sequence
Identical sequences M3XM55
ENSMPUP00000000155 XP_004743835.2.14098 XP_004743836.2.14098 XP_012907336.1.14098 XP_012907337.1.14098 ENSMPUP00000000155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]