SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000231 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000231
Domain Number 1 Region: 77-411
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.67e-55
Family Glycerol-3-phosphate transporter 0.067
Further Details:      
 
Domain Number 2 Region: 496-606
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000000000000157
Family Glycerol-3-phosphate transporter 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000231
Domain Number - Region: 433-468
Classification Level Classification E-value
Superfamily Plexin repeat 0.0615
Family Plexin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000231   Gene: ENSMPUG00000000234   Transcript: ENSMPUT00000000235
Sequence length 648
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897063.1:4000008:4374129:-1 gene:ENSMPUG00000000234 transcript:ENSMPUT00000000235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKASENVEYTLRSLSSLMGERRRKQQEPDAASAAGERSLLAAAESSASLQSAGAGGGG
VGDLERAARRQFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQ
ELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLV
VGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRY
MLGLAAIPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIE
EEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDD
RLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALLVLALGFLLSAQVSP
RITFKPVVPSGQNSTCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAW
GRCENETKFKTEDVFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWA
RSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAGVGLLFIYGCLPETKGK
KLEEIESLFDNRLCTCGASDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Download sequence
Identical sequences M3XMD1
ENSMPUP00000000231 ENSMPUP00000000231 XP_004771895.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]