SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000262 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000262
Domain Number 1 Region: 105-218
Classification Level Classification E-value
Superfamily FKBP-like 1.51e-32
Family FKBP immunophilin/proline isomerase 0.00000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000262   Gene: ENSMPUG00000000264   Transcript: ENSMPUT00000000266
Sequence length 219
Comment pep:novel scaffold:MusPutFur1.0:GL896978.1:1153968:1154643:1 gene:ENSMPUG00000000264 transcript:ENSMPUT00000000266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMGMVVPQQAWTVEQLHSKLLPKKDIIKFLQDHSSASFLAEHKLLNIKNVAKTAHKDHLV
TAYNQFFERKHFKGTESISNVSGQVKNVELNEDKPKETKSEETLDEGPPKHIKKGDKTNF
PKGDVVHCWYTGTLQDETVFDTNIQKSSKKKKNAKPLSFKVGLGKVIRGWDEAVLSMSKG
EKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVNTD
Download sequence
Identical sequences M3XMG2
ENSMPUP00000000262 ENSMPUP00000000262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]