SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000529 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000529
Domain Number 1 Region: 149-393
Classification Level Classification E-value
Superfamily vWA-like 5.56e-86
Family Integrin A (or I) domain 0.0000000519
Further Details:      
 
Domain Number 2 Region: 391-478
Classification Level Classification E-value
Superfamily Integrin domains 5.02e-23
Family Integrin domains 0.00038
Further Details:      
 
Domain Number 3 Region: 642-725
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.75e-18
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 41-98
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000471
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 600-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Integrin beta EGF-like domains 0.0024
Further Details:      
 
Domain Number 6 Region: 558-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 7 Region: 100-174
Classification Level Classification E-value
Superfamily Integrin domains 0.0000068
Family Integrin domains 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000529
Domain Number - Region: 525-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000529   Gene: ENSMPUG00000000535   Transcript: ENSMPUT00000000541
Sequence length 808
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:13684942:13758070:-1 gene:ENSMPUG00000000535 transcript:ENSMPUT00000000541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTFKFTSQGSFQSSRELKRMGIELLCLFFLFLGRNDHVQGGCAMGGAETCEDCLLIGPQ
CAWCSQENFTHPSGVGERCDTPATLLAKGCQLTFIENPVSQVEIHTNKPLSVGRQKNSSD
IVQIAPQKLTLKLRPGSEQTLQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLS
KEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDA
ERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDS
KLAGIVIPNDGLCHLDNKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYEN
YAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGALF
PHQKKCSHMKVGNTATFNVTVSIPNCERRNRHIIIKPVGLGDALEILVSPECKCDCQKEV
EVNSSKCHNGNGSFQCGVCACNPGHMGPHCECGEDTLSTESCKEAPDHPSCSGRGDCFCG
QCICHLSPYGNIYGPFCQCDNFSCVRHKGLLCGDNGVCDCGECVCRPGWAGEYCNCTTST
ESCLSEDGVPCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQ
AREECVDKCKLAGATISEAEDFSKDGSVPCSLQGENECLITFLITTDNEGKSIIHSITEK
DCPRPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNP
LYRGSTSTFKNVTYKHREKQKMDLSTDG
Download sequence
Identical sequences M3XN79
XP_004743984.1.14098 ENSMPUP00000000529 ENSMPUP00000000529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]