SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000654 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000654
Domain Number 1 Region: 38-106
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000136
Family Flavin-binding PAS domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000654   Gene: ENSMPUG00000000659   Transcript: ENSMPUT00000000666
Sequence length 116
Comment pep:novel scaffold:MusPutFur1.0:GL896909.1:16021986:16172934:-1 gene:ENSMPUG00000000659 transcript:ENSMPUT00000000666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNAKRLFLAHQKQEQP
Download sequence
Identical sequences M3XNK4
ENSMPUP00000000654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]