SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000655 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000655
Domain Number 1 Region: 38-102
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000401
Family Flavin-binding PAS domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000655   Gene: ENSMPUG00000000659   Transcript: ENSMPUT00000000667
Sequence length 130
Comment pep:novel scaffold:MusPutFur1.0:GL896909.1:16071123:16172934:-1 gene:ENSMPUG00000000659 transcript:ENSMPUT00000000667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNVTSRSSAFGGYGEPKNYV
EFEIEEDFLC
Download sequence
Identical sequences M3XNK5
ENSMPUP00000000655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]