SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000656 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000656
Domain Number 1 Region: 38-105
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000541
Family Flavin-binding PAS domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000656   Gene: ENSMPUG00000000659   Transcript: ENSMPUT00000000668
Sequence length 155
Comment pep:novel scaffold:MusPutFur1.0:GL896909.1:16130532:16172934:-1 gene:ENSMPUG00000000659 transcript:ENSMPUT00000000668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGVLMIRKLKILLSLKSLR
YRNVLSLIGNQIFENRKNKPRIILAIIKNPKDNSC
Download sequence
Identical sequences M3XNK6
ENSMPUP00000000656 ENSMPUP00000000656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]