SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000664 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000000664
Domain Number - Region: 367-399
Classification Level Classification E-value
Superfamily Kringle-like 0.0565
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000664   Gene: ENSMPUG00000000666   Transcript: ENSMPUT00000000676
Sequence length 554
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896909.1:18084260:18135264:-1 gene:ENSMPUG00000000666 transcript:ENSMPUT00000000676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQKEGALAGQAPGGKRPGRRGSSGLQPARAGGAEEVGPAATAGRLAPVSRRVRACART
PAGGGRRGGWAGLTRLPRPSSLPRAEDSVAAMGYQAQGPVIPPQSNLDDRETLVSEQKHK
GKTYHQFTAVFNVVNSIIGSGIIGLPYSMKQAGFPLGILLLFGVSYVTDFSLILLIKGGA
LSGTDTYQSLVNKTFGFPGYILLSVLQFFYPFIAMISYNIITGDTLSKVFQRIPGVDPEN
LLIGRHFIIVLSTAAFALPLSLYRDIAKLGKISFLSTVLTTLILGIVMARVVSLGPYIPK
TEDAWVFAKPSAIQALGVMSFAFICHHNCFLVYGSLEDPTVAKWSRIIHMSTLASVLIST
LFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYAVTVILTYPIECFVTREVITNVFF
GGNLSLVFHIIVTVVIITVAMLISLLIDCLGKVLELNGVLCATPLIFIIPSACYLKLSEE
PRTHSDKIMSCVMLPVGVMVMVTGLLMAVTNPQDCTHGQEMFYCFPDNLSLTNISVSHLQ
LTTQLSVLNSSIFQ
Download sequence
Identical sequences M3XNL4
ENSMPUP00000000664 ENSMPUP00000000664 XP_004744030.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]