SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000708 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000708
Domain Number 1 Region: 308-598
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.32e-76
Family Protein kinases, catalytic subunit 0.000000281
Further Details:      
 
Domain Number 2 Region: 152-235
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-34
Family Kringle modules 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000708
Domain Number - Region: 11-98
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0575
Family Frizzled cysteine-rich domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000708   Gene: ENSMPUG00000000709   Transcript: ENSMPUT00000000720
Sequence length 778
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896990.1:103219:145086:1 gene:ENSMPUG00000000709 transcript:ENSMPUT00000000720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKC
SQFAIPSLCHYAFPYCDETVSIPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKL
PNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNS
QYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEK
NKMEILYILVPSVAIPLAIALLFFFICVCRNNQKTSSPPVQRQPKHVRGQNVEMSMLNAY
KTKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTE
FQQEASLMAELQHPNIVCLLGAVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDE
DGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKVSDLGLSRE
IYSADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQ
EVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSST
TPSGGNATTQTTSLSASPVSNLSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPI
NGYPIPPGYAAFPAPHYQPAGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQE
ANIPLLPHMSIPNHPGGMGITVFGNKSQKPYKIDSKQPSLLGDSNIHGHTESMISAEL
Download sequence
Identical sequences M3XNQ8
ENSMPUP00000000708 ENSMPUP00000000708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]