SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000713 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000713
Domain Number 1 Region: 175-358
Classification Level Classification E-value
Superfamily vWA-like 0.00000000494
Family Integrin A (or I) domain 0.047
Further Details:      
 
Domain Number 2 Region: 663-771
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000785
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000713   Gene: ENSMPUG00000000715   Transcript: ENSMPUT00000000726
Sequence length 1223
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896990.1:389679:594580:1 gene:ENSMPUG00000000715 transcript:ENSMPUT00000000726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLAAEELGVVTMQRIFNSFVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRNKQVVE
ASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTISCDQLSTTVNSRAFNPGRDLN
SVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVV
ILDHGASVTDTQLQIAKDAARVILSAIDEHDKISVLTVADTVRTCSLDQCYKTFLSPATS
ETKRKMSTFVSGVKSLDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSK
DSSEEDKKATLRVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVL
DRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSK
PCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEP
PLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRATGKEAYNVSYA
WKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLE
SPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHV
TDEWMTQMEMSSLNTYIVRRYIATPNGILRIYPGSLMDKAFDPTRRQWYLHAVANPGLIS
LTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQD
GGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCN
SFSDRTVQRFYKFNTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCAC
SMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYTALDPG
LQDALHQCVNSRCSQRMESGDCFGVLDCEWCMVDSDGKTHLDKSYCAPQKECFGGIVGAK
SPYVDDMGAIGDEVVTLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSP
LAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGT
ESDHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHDEDLDLDTPPQTAALLSHKFPHPRPH
HPTLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences M3XNR3
ENSMPUP00000000713 ENSMPUP00000000713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]