SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000803 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000803
Domain Number 1 Region: 52-518
Classification Level Classification E-value
Superfamily Sema domain 5.23e-156
Family Sema domain 0.0000000755
Further Details:      
 
Domain Number 2 Region: 514-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000192
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000803   Gene: ENSMPUG00000000806   Transcript: ENSMPUT00000000818
Sequence length 1031
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896966.1:5310275:5439564:-1 gene:ENSMPUG00000000806 transcript:ENSMPUT00000000818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQM
IMTMNRTLYVAARDHIYTVDMDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKKNDDTLFVCGTNAFNPSCRNYKMDTLEPSGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIA
VEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLEKYTTSNEFPDDTLNFIKTHPLMDEAVPSVINRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARVGNSGFLNDSLFLEEMSVYNPEKCSYD
GVEDKRIMGMQLDKASSSLYVAFSTCVIKLPLGRCERHGKCKKTCIASRDPYCGWVKEGG
ACAHLSPSSRLTFEQDIERGSTEGLGDCHNSFVALNGHSSSLLPSTTTSDTAAQEGYESR
AGMLDWKDLLHSPDSTDSLGAVSSRNHQDKKGVIRESYLKGHDQLVPVTLLAIAVILAFV
MGAVFSGIIVYCVCDHRRKDVSSVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPE
AILTPLMHNGKLATPGNTAKMLIKADQHHLDLAALPTPESTPTLQQKRKPSRGSREWERN
QNLINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVAQ
MALEDQAATLEYKTIKEHLSSKSPNHGVNLVDNLDSLPPKVPQREASLGPPGASLSQNGL
SKRLEMHHSSSYGLDYKRSYPTTNSLTRSHQATTLKRNNTNCSNSSHLSRNQSFGRGDNP
PPAPQRVDSIQVHGAQPSGQAVTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKPSFAPL
STSMKPNDACT
Download sequence
Identical sequences M3XP03
XP_004759134.1.14098 ENSMPUP00000000803 ENSMPUP00000000803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]