SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001047 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001047
Domain Number 1 Region: 375-489,608-748
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.32e-66
Family Phosphate binding protein-like 0.00000000109
Further Details:      
 
Domain Number 2 Region: 2-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.12e-61
Family L-arabinose binding protein-like 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001047
Domain Number - Region: 499-603
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000824
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001047   Gene: ENSMPUG00000001055   Transcript: ENSMPUT00000001068
Sequence length 878
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896955.1:5261402:5406778:-1 gene:ENSMPUG00000001055 transcript:ENSMPUT00000001068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQSICNALEVPHI
QTRWKHPSVDNKDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDSTGLIRLQELIK
APSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHGTAAEILKQILFMGMMTE
YYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSMERLQAPPRPETG
LLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDG
LTGRITFNKTDGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTD
GNKDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILG
FIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHKADLAVAPLTITYVREKVIDFSKPFMTL
GISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCN
PDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLA
AFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRQQTA
LVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRD
KITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFIVLAAGLVLSVF
VAIGEFIYKSRKNNDIEQKGKSSRIRFYFRNKVRFHGRKKQSLGVEKCLSFNAIMEELGI
SLKNQKKLKKKSRTKGKSPFTSILTCHQRRTQRKETVA
Download sequence
Identical sequences M3XPP7
ENSMPUP00000001047 ENSMPUP00000001047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]