SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001148 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001148
Domain Number 1 Region: 9-179
Classification Level Classification E-value
Superfamily Ribosomal protein S2 3.53e-22
Family Ribosomal protein S2 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001148   Gene: ENSMPUG00000001159   Transcript: ENSMPUT00000001173
Sequence length 252
Comment pep:novel scaffold:MusPutFur1.0:GL896931.1:12780833:12781613:-1 gene:ENSMPUG00000001159 transcript:ENSMPUT00000001173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRIFDVLQMKEDGVLKFLAAGIHSGGTNLTSKRNYIYKRKSDGIFSINLENLGVASVGS
SGHCCHRNPTDVRVMTFRNTGQRVVRKFAAILGPPTMAGRFTSRAFINQIQGVFQEQRLL
VVTAARADHWPLTDVSGVDLPTTAMVEQPICCTCKGAHSVGLMWRVPPRELRMRGTRSWV
QLEEVLPDLSFHRDSEEIRAEPTAAEKAVTTEEFQSERTAPAPGFTTPQPEVTDRSEGMR
VTSVPCQQIPAQ
Download sequence
Identical sequences M3XPZ8
ENSMPUP00000001148 ENSMPUP00000001148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]