SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001790 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000001790
Domain Number - Region: 72-123
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00036
Family VPS37 C-terminal domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001790   Gene: ENSMPUG00000001808   Transcript: ENSMPUT00000001826
Sequence length 327
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896936.1:3048804:3058616:1 gene:ENSMPUG00000001808 transcript:ENSMPUT00000001826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQTQNVQLNKEMTLASNRSLAEGNLLYQPQLDALKARLTQKYQELQVLFEAYQIKKTKL
DQQSSRASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSQRKLAHTRRV
KIEKLQELVLKGQRLPQASVPAPLLPRVPVPEPVPAAPLPYPTSEASGPPSMLPRRIPPP
PPPRLGGGPCLQGYTPPAPQCPPPPSPWQSRKAGPCAPLQNMAGIGPPGGRGTGPFPARA
LTPAPGGPAGGPRWASGPGAPLRGAALGRPGSPSPSPVPKAPAEPRGAPAPQTLPQSSAQ
HLRWPWPWPPSPCPPWPQAPPDAHPGS
Download sequence
Identical sequences M3XRU0
ENSMPUP00000001790 ENSMPUP00000001790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]