SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001802 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001802
Domain Number 1 Region: 195-273
Classification Level Classification E-value
Superfamily S13-like H2TH domain 8.98e-21
Family Middle domain of MutM-like DNA repair proteins 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001802
Domain Number - Region: 2-61
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0188
Family N-terminal domain of MutM-like DNA repair proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001802   Gene: ENSMPUG00000001820   Transcript: ENSMPUT00000001838
Sequence length 334
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897016.1:2103755:2117898:1 gene:ENSMPUG00000001820 transcript:ENSMPUT00000001838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPSVRKFHRLVSPFVGQQVVKTGGSSQKLTPASLQSLWLQDTQVHGKKLFLRFEPDE
ELGSLDNISLPESLEKGERKEEAQDQKQASGPSSQKTSQPPSQSLEHVAPSGDSGLEGLR
GDAAVGAAERWLQVSFGMFGSIWVNEFSRAKKANKRGDWRDPIPRLVLYFGGGGFLAFYN
CQMSWSSSPVVRPASDILSEKFDRRQALEALSQEQPVCYTLLDQRYFSGLGNIIKNEALY
RAGIHPLSLGSLLSHQHLEALVDHVVEFSVDWLQGKFEGRQQHPQIYQKEQCPGGHRVMR
EAFGPPGGFQRLTWWCPQCQPRLSPDEQGQVQLS
Download sequence
Identical sequences M3XRV2
ENSMPUP00000001802 ENSMPUP00000001802 XP_004766136.1.14098 XP_004766137.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]